Recombinant Mouse E3 ubiquitin-protein ligase Mdm2 | MyBioSource MBS964250 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Mouse E3 ubiquitin-protein ligase Mdm2

catalog :

MBS964250

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS964250

products type :

Recombinant Protein

products full name :

Recombinant Mouse E3 ubiquitin-protein ligase Mdm2

products short name :

E3 ubiquitin-protein ligase Mdm2

products name syn :

Double minute 2 protein; Oncoprotein Mdm2; p53-binding protein Mdm2

other names :

E3 ubiquitin-protein ligase Mdm2; E3 ubiquitin-protein ligase Mdm2; E3 ubiquitin-protein ligase Mdm2; transformed mouse 3T3 cell double minute 2; Double minute 2 protein; Oncoprotein Mdm2; p53-binding protein Mdm2

products gene name :

Mdm2

other gene names :

Mdm2; Mdm2; Mdm-2; AA415488; 1700007J15Rik

uniprot entry name :

MDM2_MOUSE

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

1-489

sequence length :

440

sequence :

MCNTNMSVSTEGAASTSQIPASEQETLVRPKPLLLKLLK
SVGAQNDTYTMKEIIFYIGQYIMTKRLYDEKQQHIVYCS
NDLLGDVFGVPSFSVKEHRKIYAMIYRNLVAVSQQDSGT
SLSESRRQPEGGSDLKDPLQAPPEEKPSSSDLISRLSTS
SRRRSISETEENTDELPGERHRKRRRSLSFDPSLGLCEL
REMCSGGSSSSSSSSSESTETPSHQDLDDGVSEHSGDCL
DQDSVSDQFSVEFEVESLDSE

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

E3 ubiquitin-protein ligase that mediates ubiquitination of p53/TP53, leading to its degradation by the proteasome. Inhibits p53/TP53- and p73/TP73-mediated cell cycle arrest and apoptosis by binding its transcriptional activation domain. Also acts as a ubiquitin ligase E3 toward itself and ARRB1. Permits the nuclear export of p53/TP53. Promotes proteasome-dependent ubiquitin-independent degradation of retinoblastoma RB1 protein. Inhibits DAXX-mediated apoptosis by inducing its ubiquitination and degradation. Component of the TRIM28/KAP1-MDM2-p53/TP53 complex involved in stabilizing p53/TP53. Also component of the TRIM28/KAP1-ERBB4-MDM2 complex which links growth factor and DNA damage response pathways. Mediates ubiquitination and subsequent proteasome degradation of DYRK2 in nucleus. Ubiquitinates IGF1R and SNAI1 and promotes th to proteasomal degradation.

products references :

Tumorigenic potential associated with enhanced expression of a gene that is amplified in a mouse tumor cell line.Fakharzadeh S.S., Trusko S.P., George D.L.EMBO J. 10:1565-1569(1991) Genomic organization of the mouse double minute 2 gene.Jones S.N., Ansari-Lari M.A., Hancock A.R., Jones W.J., Gibbs R.A., Donehower L.A., Bradley A.Gene 175:209-213(1996) The organization and expression of the mdm2 gene.de Oca Luna R.M., Tabor A.D., Eberspaecher H., Hulboy D.L., Worth L.L., Colman M.S., Finlay C.A., Lozano G.Genomics 33:352-357(1996) Multiple murine double minute gene 2 (MDM2) proteins are induced by ultraviolet light.Saucedo L.J., Myers C.D., Perry M.E.J. Biol. Chem. 274:8161-8168(1999) Cooperative signals governing ARF-mdm2 interaction and nucleolar localization of the complex.Weber J.D., Kuo M.-L., Bothner B., DiGiammarino E.L., Kriwacki R.W., Roussel M.F., Sherr C.J.Mol. Cell. Biol. 20:2517-2528(2000) Rapid ATM-dependent phosphorylation of MDM2 precedes p53 accumulation in response to DNA damage.Khosravi R., Maya R., Gottlieb T., Oren M., Shiloh Y., Shkedy D.Proc. Natl. Acad. Sci. U.S.A. 96:14973-14977(1999) A novel cellular protein (MTBP) binds to MDM2 and induces a G1 arrest that is suppressed by MDM2.Boyd M.T., Vlatkovic N., Haines D.S.J. Biol. Chem. 275:31883-31890(2000) Regulation of receptor fate by ubiquitination of activated beta 2-adrenergic receptor and beta-arrestin.Shenoy S.K., McDonald P.H., Kohout T.A., Lefkowitz R.J.Science 294:1307-1313(2001) PML regulates p53 stability by sequestering Mdm2 to the nucleolus.Bernardi R., Scaglioni P.P., Bergmann S., Horn H.F., Vousden K.H., Pandolfi P.P.Nat. Cell Biol. 6:665-672(2004) A novel nuclear interactor of ARF and MDM2 (NIAM) that maintains chromosomal stability.Tompkins V.S., Hagen J., Frazier A.A., Lushnikova T., Fitzgerald M.P., di Tommaso A.D., Ladeveze V., Domann F.E., Eischen C.M., Quelle D.E.J. Biol. Chem. 282:1322-1333(2007)

ncbi gi num :

570700841

ncbi acc num :

NP_001275515.1

ncbi gb acc num :

NM_001288586.1

uniprot acc num :

P23804

ncbi mol weight :

58.6kD

ncbi pathways :

AKT Phosphorylates Targets In The Cytosol Pathway (1323658); Adaptive Immune System Pathway (1323640); Androgen Receptor Signaling Pathway (198319); Apoptosis Pathway (198339); Bladder Cancer Pathway (83308); Bladder Cancer Pathway (527); Cell Cycle Pathway (1323926); Cell Cycle Checkpoints Pathway (1323927); Cell Cycle Pathway (83251); Cell Cycle Pathway (198407)

uniprot summary :

MDM2: a ubiquitin ligase for p53, plays a central role in regulation of the stability of p53 via Akt-mediated MDM2 phosphorylation. Phosphorylation of MDM2 increases its interaction with p300, providing a platform to allow the assembly of the protein complex necessary for MDM2-mediated ubiquitination and degradation of p53. Phosphorylation of MDM2 also blocks its binding to p19ARF, increasing the degradation of p53. Facilitates the nuclear export of p53 and targets it for proteasome-mediated proteolysis. Eight alternatively spliced isoforms have been reported. Protein type: Oncoprotein; Nucleolus; Inhibitor; EC 6.3.2.19; Ligase; Ubiquitin ligase; EC 6.3.2.-; Ubiquitin conjugating system. Cellular Component: cytoplasm; cytosol; nuclear body; nucleolus; nucleoplasm; nucleus; plasma membrane; protein complex; synapse. Molecular Function: coenzyme F420-0 gamma-glutamyl ligase activity; coenzyme F420-2 alpha-glutamyl ligase activity; enzyme binding; identical protein binding; ligase activity; metal ion binding; p53 binding; peroxisome proliferator activated receptor binding; protein binding; ribosomal S6-glutamic acid ligase activity; ubiquitin protein ligase binding; ubiquitin-protein ligase activity; UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate-D-alanyl-D-alanine ligase activity; zinc ion binding. Biological Process: blood vessel development; blood vessel remodeling; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; establishment of protein localization; heart development; negative regulation of apoptosis; negative regulation of caspase activity; negative regulation of DNA damage response, signal transduction by p53 class mediator; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; peptidyl-lysine modification; positive regulation of cell cycle; positive regulation of mitotic cell cycle; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; positive regulation of protein export from nucleus; protein complex assembly; protein destabilization; protein ubiquitination; protein ubiquitination during ubiquitin-dependent protein catabolic process; regulation of gene expression; regulation of heart rate; regulation of protein catabolic process; traversing start control point of mitotic cell cycle

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.05 mg (Yeast)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.2 mg (Yeast)

price4 :

460

size5 :

0.5 mg (Yeast)

price5 :

750

more info or order :

MyBioSource product webpage