This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human B-lymphocyte antigen CD19 (CD19)
catalog :
MBS964168
quantity :
0.05 mg (E-Coli)
price :
305 USD
product information
catalog number :
MBS964168
products type :
Recombinant Protein
products full name :
Recombinant Human B-lymphocyte antigen CD19 (CD19)
products short name :
B-lymphocyte antigen CD19 (CD19)
products name syn :
B-lymphocyte antigen CD19; B-lymphocyte surface antigen B4; Differentiation antigen CD19; T-cell surface antigen Leu-12; CD_antigen=; CD19
other names :
B-lymphocyte antigen CD19 isoform 1; B-lymphocyte antigen CD19; B-lymphocyte antigen CD19; differentiation antigen CD19; T-cell surface antigen Leu-12; B-lymphocyte surface antigen B4; CD19 molecule; B-lymphocyte surface antigen B4; Differentiation antigen CD19; T-cell surface antigen Leu-12; CD_antigen: CD19
products gene name :
CD19
other gene names :
CD19; CD19; B4; CVID3
uniprot entry name :
CD19_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
20-291,Partial. Provide the complete extracellular domain
sequence length :
291
sequence :
PEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPL
KPFLKLSLGLPGLGIHMRPLAIWLFIFNVSQQMGGFYLC
QPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGL
KNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLP
PRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSW
THVHPKGPKSLLSLELKDDRPARDMWVMETGLLLPRATA
QDAGKYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWK
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Homo sapiens (Human)
ncbi gi num :
296010921
ncbi acc num :
NP_001171569.1
ncbi gb acc num :
NM_001178098.1
uniprot acc num :
P15391
ncbi mol weight :
61,200 Da
ncbi pathways :
Adaptive Immune System Pathway (366160); Antigen Activates B Cell Receptor Leading To Generation Of Second Messengers Pathway (576249); B Cell Receptor Signaling Pathway (198909); B Cell Receptor Signaling Pathway (83081); B Cell Receptor Signaling Pathway (492); BCR Signaling Pathway (138058); Constitutive PI3K/AKT Signaling In Cancer Pathway (685535); DAP12 Interactions Pathway (685549); DAP12 Signaling Pathway (685550); Disease Pathway (530764)
ncbi summary :
Lymphocytes proliferate and differentiate in response to various concentrations of different antigens. The ability of the B cell to respond in a specific, yet sensitive manner to the various antigens is achieved with the use of low-affinity antigen receptors. This gene encodes a cell surface molecule which assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation. [provided by RefSeq, Jul 2008]
uniprot summary :
CD19: a cell surface molecule which assembles with the antigen receptor of B lymphocytes. A critical signal transduction molecule that regulates B lymphocyte development, activation, and differentiation. Ligation increases intracellular calcium levels and decreases the threshold for antigen receptor signaling. Germinal center formation is significantly reduced in CD19-deficient mice. Protein type: Cell surface; Membrane protein, integral. Chromosomal Location of Human Ortholog: 16p11.2. Cellular Component: protein complex; integral to plasma membrane; plasma membrane; external side of plasma membrane. Molecular Function: receptor signaling protein activity. Biological Process: epidermal growth factor receptor signaling pathway; B cell receptor signaling pathway; regulation of immune response; phosphoinositide-mediated signaling; cell surface receptor linked signal transduction; fibroblast growth factor receptor signaling pathway; nerve growth factor receptor signaling pathway; innate immune response; cellular defense response; positive regulation of release of sequestered calcium ion into cytosol. Disease: Immunodeficiency, Common Variable, 2; Immunodeficiency, Common Variable, 3
size1 :
0.05 mg (E-Coli)
price1 :
305 USD
size2 :
0.2 mg (E-Coli)
price2 :
580
size3 :
0.05 mg (Baculovirus)
price3 :
950
size4 :
0.5 mg (E-Coli)
price4 :
950
size5 :
0.05 mg (Mammalian-Cell)
price5 :
1170
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!