product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human ATP synthase subunit beta, mitochondrial (ATP5B)
catalog :
MBS964125
quantity :
0.05 mg (E-Coli)
price :
180 USD
more info or order :
product information
catalog number :
MBS964125
products type :
Recombinant Protein
products full name :
Recombinant Human ATP synthase subunit beta, mitochondrial (ATP5B)
products short name :
ATP synthase subunit beta, mitochondrial (ATP5B)
products name syn :
ATP synthase subunit beta, mitochondrial; EC=3.6.3.14
other names :
ATP synthase subunit beta, mitochondrial; ATP synthase subunit beta, mitochondrial; ATP synthase subunit beta, mitochondrial; epididymis secretory protein Li 271; mitochondrial ATP synthase beta subunit; mitochondrial ATP synthetase, beta subunit; ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide
products gene name :
ATP5B
products gene name syn :
ATP5B; ATPMB; ATPSB
other gene names :
ATP5B; ATP5B; ATPMB; ATPSB; HEL-S-271; ATPMB; ATPSB
uniprot entry name :
ATPB_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
48-529, Mature full length protein.
sequence length :
529
sequence :
AQTSPSPKAGAATGRIVAVIGAVVDVQFDEGLPPILNAL
EVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKV
LDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFA
PIHAEAPEFMEMSVEQEILVTGIKVVDLLAPYAKGGKIG
LFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTRE
GNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARAR
VALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSA
LLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQA
IYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAV
DPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDI
IAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTG
HMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEE
AVAKADKLAEEHSS
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Homo sapiens (Human)
products description :
Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core, and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Subunits alpha and beta form the catalytic core in F1. Rotation of the central stalk against the surrounding alpha3beta3 subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits.
ncbi gi num :
32189394
ncbi acc num :
NP_001677.2
ncbi gb acc num :
NM_001686.3
uniprot acc num :
P06576
ncbi mol weight :
68kD
ncbi pathways :
Alzheimer's Disease Pathway (83097); Alzheimer's Disease Pathway (509); Electron Transport Chain Pathway (198860); F-type ATPase, Eukaryotes Pathway (522535); Formation Of ATP By Chemiosmotic Coupling Pathway (105922); Huntington's Disease Pathway (83100); Huntington's Disease Pathway (512); Metabolism Pathway (477135); Metabolism Of Proteins Pathway (106230); Mitochondrial Protein Import Pathway (576261)
ncbi summary :
This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the beta subunit of the catalytic core. [provided by RefSeq, Jul 2008]
uniprot summary :
ATP5B: Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Subunits alpha and beta form the catalytic core in F(1). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. Belongs to the ATPase alpha/beta chains family. Protein type: Energy Metabolism - oxidative phosphorylation; EC 3.6.3.14; Hydrolase; Mitochondrial. Chromosomal Location of Human Ortholog: 12q13.13. Cellular Component: mitochondrial proton-transporting ATP synthase, catalytic core; cell surface; membrane; mitochondrion; mitochondrial matrix; mitochondrial membrane; plasma membrane; nucleus; mitochondrial proton-transporting ATP synthase complex. Molecular Function: protein binding; MHC class I protein binding; transporter activity; ATPase activity; hydrogen ion transporting ATP synthase activity, rotational mechanism; transmembrane transporter activity; hydrogen ion transporting ATPase activity, rotational mechanism; ATP binding. Biological Process: mitochondrion organization and biogenesis; substrate-bound cell migration, cell release from substrate; generation of precursor metabolites and energy; organelle organization and biogenesis; osteoblast differentiation; cellular metabolic process; proton transport; ATP biosynthetic process; regulation of intracellular pH; ATP hydrolysis coupled proton transport; mitochondrial ATP synthesis coupled proton transport; lipid metabolic process; angiogenesis
size1 :
0.05 mg (E-Coli)
price1 :
180 USD
size2 :
0.05 mg (Yeast)
price2 :
260
size3 :
0.2 mg (E-Coli)
price3 :
490
size4 :
0.2 mg (Yeast)
price4 :
600
size5 :
0.5 mg (E-Coli)
price5 :
715
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!