protein

Recombinant Mouse Cellular tumor antigen p53

MBS963888

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Mouse Cellular tumor antigen p53

Cellular tumor antigen p53

Tumor suppressor p53

cellular tumor antigen p53 isoform b; Cellular tumor antigen p53; cellular tumor antigen p53; transformation related protein 53; Tumor suppressor p53

Tp53

Trp53; Tp53; bbl; bfy; bhy; p44; p53; Tp53; P53; Trp53

P53_MOUSE

E Coli or Yeast or Baculovirus or Mammalian Cell

1-387

381

MEESQSDISLELPLSQETFSGLWKLLPPEDILPSPHCMD
DLLLPQDVEEFFEGPSEALRVSGAPAAQDPVTETPGPVA
PAPATPWPLSSFVPSQKTYQGNYGFHLGFLQSGTAKSVM
CTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAI
YKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNL
YPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNS
SCMGGMNRRPILTIITLEDSS

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. One of the activated genes is an inhibitor of cyclin-dependent kinases. Apoptosis induction ses to be mediated either by stimulation of BAX and FAS antigen expression, or by repression of Bcl-2 expression. In cooperation with mitochondrial PPIF is involved in activating oxidative stress-induced necrosis; the function is largely independent of transcription. Prevents CDK7 kinase activity when associated to CAK complex in response to DNA damage, thus stopping cell cycle progression. Induces the transcription of long intergenic non-coding RNA p21 (lincRNA-p21) and lincRNA-Mkln1. LincRNA-p21 participates in TP53-dependent transcriptional repression leading to apoptosis, but ses to have to effect on cell-cycle regulation. Regulates the circadian clock by repressing CLOCK-ARNTL/BMAL1-mediated transcriptional activation of PER2.

Analysis of the gene coding for the murine cellular tumour antigen p53.Bienz B., Zakut-Houri R., Givol D., Oren M.EMBO J. 3:2179-2183(1984) A single gene and a pseudogene for the cellular tumour antigen p53.Zakut-Houri R., Oren M., Bienz B., Lavie V., Hazum S., Givol D.Nature 306:594-597(1983) Cloning and expression analysis of full length mouse cDNA sequences encoding the transformation associated protein p53.Jenkins J.R., Rudge K., Redmond S., Wade-Evans A.Nucleic Acids Res. 12:5609-5626(1984) Immunologically distinct p53 molecules generated by alternative splicing.Arai N., Nomura D., Yokota K., Wolf D., Brill E., Shohat O., Rotter V.Mol. Cell. Biol. 6:3232-3239(1986) Primary structure of DNA complementary to mRNA of murine oncoprotein p53.Chumakov P.M.Bioorg. Khim. 13:1691-1694(1987) Cell cycle in DNA-PKcs knock-out mice.Araki R., Fukumura R., Fujimori A., Tatsumi K., Abe M. DNA-dependent protein kinase is not required for the p53-dependent response to DNA damage.Jimenez G.S., Bryntesson F., Torres-Arzayus M.I., Priestley A., Beeche M., Saito S., Sakaguchi K., Appella E., Jeggo P.A., Taccioli G.E., Wahl G.M., Hubank M.Nature 400:81-83(1999) Characterization of DNA-PKcs null mutant SX9.Araki R., Fukumura R., Fujimori A., Tatsumi K., Abe M. p53 in 129-SVJ mice.Fujimori A., Abe M. Loss of heterozygosity and mutational alterations of the p53 gene in skin tumours of interspecific hybrid mice.Burns P.A., Kemp C.J., Gannon J.V., Lane D.P., Bremner R., Balmain A.Oncogene 6:2363-2369(1991) Detection of a transformation-related antigen in chemically induced sarcomas and other transformed cells of the mouse.DeLeo A.B., Jay G., Appella E., Dubois G.C., Law L.W., Old L.J.Proc. Natl. Acad. Sci. U.S.A. 76:2420-2424(1979) p53 is involved in the p120E4F-mediated growth arrest.Sandy P., Gostissa M., Fogal V., Cecco L.D., Szalay K., Rooney R.J., Schneider C., Del Sal G.Oncogene 19:188-199(2000) Characterization of cells and gene-targeted mice deficient for the p53-binding kinase homeodomain-interacting protein kinase 1 (HIPK1) .Kondo S., Lu Y., Debbas M., Lin A.W., Sarosi I., Itie A., Wakeham A., Tuan J., Saris C., Elliott G., Ma W., Benchimol S., Lowe S.W., Mak T.W., Thukral S.K.Proc. Natl. Acad. Sci. U.S.A. 100:5431-5436(2003) Axin stimulates p53 functions by activation of HIPK2 kinase through multimeric complex formation.Rui Y., Xu Z., Lin S., Li Q., Rui H., Luo W., Zhou H.-M., Cheung P.-Y., Wu Z., Ye Z., Li P., Han J., Lin S.-C.EMBO J. 23:4583-4594(2004) Mapping of phosphomonoester and apparent phosphodiester bonds of the oncogene product p53 from simian virus 40-transformed 3T3 cells.Samad A., Anderson C.W., Carroll R.B.Proc. Natl. Acad. Sci. U.S.A. 83:897-901(1986) The p53 tumour suppressor protein is phosphorylated at serine 389 by casein kinase II.Meek D.W., Simon S., Kikkawa U., Eckhart W.EMBO J. 9:3253-3260(1990) p53 is covalently linked to 5.8S rRNA.Fontoura B.M., Sorokina E.A., David E., Carroll R.B.Mol. Cell. Biol. 12:5145-5151(1992) Negative control of p53 by Sir2alpha promotes cell survival under stress.Luo J., Nikolaev A.Y., Imai S., Chen D., Su F., Shiloh A., Guarente L., Gu W.Cell 107:137-148(2001) Identification and characterization of murine mHAUSP encoding a deubiquitinating enzyme that regulates the status of p53 ubiquitination.Lim S.-K., Shin J.-M., Kim Y.-S., Baek K.-H.Int. J. Oncol. 24:357-364(2004) Differential effect of ik3-1/cables on p53- and p73-induced cell death.Tsuji K., Mizumoto K., Yamochi T., Nishimoto I., Matsuoka M.J. Biol. Chem. 277:2951-2957(2002) Direct interaction with and activation of p53 by SMAR1 retards cell-cycle progression at G2/M phase and delays tumor growth in mice.Kaul R., Mukherjee S., Ahmed F., Bhat M.K., Chhipa R., Galande S., Chattopadhyay S.Int. J. Cancer 103:606-615(2003) PML regulates p53 stability by sequestering Mdm2 to the nucleolus.Bernardi R., Scaglioni P.P., Bergmann S., Horn H.F., Vousden K.H., Pandolfi P.P.Nat. Cell Biol. 6:665-672(2004) PRAK is essential for ras-induced senescence and tumor suppression.Sun P., Yoshizuka N., New L., Moser B.A., Li Y., Liao R., Xie C., Chen J., Deng Q., Yamout M., Dong M.Q., Frangou C.G., Yates J.R. III, Wright P.E., Han J.Cell 128:295-308(2007) Hzf Determines cell survival upon genotoxic stress by modulating p53 transactivation.Das S., Raj L., Zhao B., Kimura Y., Bernstein A., Aaronson S.A., Lee S.W.Cell 130:624-637(2007) Novel homeodomain-interacting protein kinase family member, HIPK4, phosphorylates human p53 at serine 9.Arai S., Matsushita A., Du K., Yagi K., Okazaki Y., Kurokawa R.FEBS Lett. 581:5649-5657(2007) CHD8 suppresses p53-mediated apoptosis through histone H1 recruitment during early embryogenesis.Nishiyama M., Oshikawa K., Tsukada Y.I., Nakagawa T., Iemura S., Natsume T., Fan Y., Kikuchi A., Skoultchi A.I., Nakayama K.I.Nat. Cell Biol. 11:172-182(2009) Trim24 targets endogenous p53 for degradation.Allton K., Jain A.K., Herz H.M., Tsai W.W., Jung S.Y., Qin J., Bergmann A., Johnson R.L., Barton M.C.Proc. Natl. Acad. Sci. U.S.A. 106:11612-11616(2009) A large intergenic noncoding RNA induced by p53 mediates global gene repression in the p53 response.Huarte M., Guttman M., Feldser D., Garber M., Koziol M.J., Kenzelmann-Broz D., Khalil A.M., Zuk O., Amit I., Rabani M., Attardi L.D., Regev A., Lander E.S., Jacks T., Rinn J.L.Cell 142:409-419(2010) p53 opens the mitochondrial permeability transition pore to trigger necrosis.Vaseva A.V., Marchenko N.D., Ji K., Tsirka S.E., Holzmann S., Moll U.M.Cell 149:1536-1548(2012) SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013) p53 regulates Period2 expression and the circadian clock.Miki T., Matsumoto T., Zhao Z., Lee C.C.Nat. Commun. 4:2444-2444(2013) Crystal structure of the mouse p53 core DNA-binding domain at 2.7 A resolution.Zhao K., Chai X., Johnston K., Clements A., Marmorstein R.J. Biol. Chem. 276:12120-12127(2001) High-resolution structure of the p53 core domain implications for binding small-molecule stabilizing compounds.Ho W.C., Luo C., Zhao K., Chai X., Fitzgerald M.X., Marmorstein R.Acta Crystallogr. D 62:1484-1493(2006) Structure of the p53 core domain dimer bound to DNA.Ho W.C., Fitzgerald M.X., Marmorstein R.J. Biol. Chem. 281:20494-20502(2006) Crystal structure of the mouse p53 core domain in zinc-free state.Kwon E., Kim D.Y., Suh S.W., Kim K.K.Proteins 70:280-283(2008) Crystal structure of a p53 core tetramer bound to DNA.Malecka K.A., Ho W.C., Marmorstein R.Oncogene 28:325-333(2009)

187960040

NP_001120705.1

NM_001127233.1

P02340

59.1kD

Amyotrophic Lateral Sclerosis (ALS) Pathway (83296); Amyotrophic Lateral Sclerosis (ALS) Pathway (511); Androgen Receptor Signaling Pathway (198319); Apoptosis Pathway (198339); Apoptosis Pathway (83257); Apoptosis Pathway (470); Apoptosis Signaling Pathway (522973); Autodegradation Of The E3 Ubiquitin Ligase COP1 Pathway (1323932); Basal Cell Carcinoma Pathway (83306); Basal Cell Carcinoma Pathway (525)

This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where it's believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mice deficient for this gene are developmentally normal but are susceptible to spontaneous tumors. Evidence to date shows that this gene contains one promoter, in contrast to alternative promoters of the human gene, and transcribes a few of splice variants which encode different isoforms, although the biological validity or the full-length nature of some variants has not been determined. [provided by RefSeq, Jul 2008]

p53: a transcription factor and major tumor suppressor that plays a major role in regulating cellular responses to DNA damage and other genomic aberrations. Activation of p53 can lead to either cell cycle arrest and DNA repair or apoptosis. More than 50 percent of human tumors contain a mutation or deletion of the TP53 gene. p53 is modified post-translationally at multiple sites. DNA damage induces phosphorylation of p53 at S15, S20 and S37, reducing its interaction with the oncoprotein MDM2. MDM2 inhibits p53 accumulation by targeting it for ubiquitination and proteasomal degradation. Phosphorylated by many kinases including Chk2 and Chk1 at S20, enhancing its tetramerization, stability and activity. The phosphorylation by CAK at S392 is increased in human tumors and has been reported to influence the growth suppressor function, DNA binding and transcriptional activation of p53. Phosphorylation of p53 at S46 regulates the ability of p53 to induce apoptosis. The acetylation of p53 appears to play a positive role in the accumulation of p53 during the stress response. Following DNA damage, p53 becomes acetylated at K382, enhancing its binding to DNA. Deacetylation of p53 can occur through interaction with SIRT1, a deacetylase that may be involved in cellular aging and the DNA damage response. p53 regulates the transcription of a set of genes encoding endosomal proteins that regulate endosomal functions. These include STEAP3 and CHMP4C, which enhance exosome production, and CAV1 and CHMP4C, which produce a more rapid endosomal clearance of the EGFR from the plasma membrane. DNA damage regulates a p53-mediated secretory pathway, increasing the secretion of some proteins such as Hsp90, SERPINE1, SERPINB5, NKEF-A, and CyPA, and inhibiting the secretion of others including CTSL and IGFBP-2. Two alternatively spliced human isoforms have been reported. Isoform 2 is expressed in quiescent lymphocytes. Seems to be non-functional. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. Protein type: DNA-binding; Activator; Transcription factor; Nuclear receptor co-regulator; Motility/polarity/chemotaxis; Tumor suppressor. Cellular Component: chromatin; cytoplasm; cytosol; endoplasmic reticulum; mitochondrial matrix; mitochondrion; nuclear body; nuclear chromatin; nuclear matrix; nucleolus; nucleoplasm; nucleus; PML body; protein complex; replication fork; transcription factor complex; transcription factor TFIID complex. Molecular Function: ATP binding; chaperone binding; chromatin binding; copper ion binding; damaged DNA binding; DNA binding; enzyme binding; histone acetyltransferase binding; histone deacetylase regulator activity; identical protein binding; metal ion binding; p53 binding; protease binding; protein binding; protein C-terminus binding; protein heterodimerization activity; protein kinase binding; protein N-terminus binding; protein phosphatase 2A binding; protein phosphatase binding; protein self-association; receptor tyrosine kinase binding; sequence-specific DNA binding; transcription factor activity; transcription factor binding; ubiquitin protein ligase binding. Biological Process: apoptosis; B cell lineage commitment; cell aging; cell cycle; cell cycle arrest; cellular response to glucose starvation; central nervous system development; cerebellum development; chromatin assembly; chromosome breakage; chromosome organization and biogenesis; circadian behavior; determination of adult life span; DNA damage response, signal transduction by p53 class mediator; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis; DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator; DNA strand renaturation; double-strand break repair; embryonic development ending in birth or egg hatching; embryonic organ development; entrainment of circadian clock by photoperiod; ER overload response; G1 DNA damage checkpoint; gastrulation; heart development; in utero embryonic development; mitochondrial DNA repair; multicellular organism growth; multicellular organismal development; negative regulation of apoptosis; negative regulation of cell growth; negative regulation of cell proliferation; negative regulation of DNA replication; negative regulation of fibroblast proliferation; negative regulation of mitotic cell cycle; negative regulation of neuroblast proliferation; negative regulation of proteolysis; negative regulation of smooth muscle cell proliferation; negative regulation of telomerase activity; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; negative regulation of transforming growth factor beta receptor signaling pathway; neuron apoptosis; nucleotide-excision repair; positive regulation of apoptosis; positive regulation of cell cycle; positive regulation of histone deacetylation; positive regulation of leukocyte migration; positive regulation of neuron apoptosis; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of protein oligomerization; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; programmed cell death; protein complex assembly; protein import into nucleus, translocation; protein localization; protein stabilization; protein tetramerization; regulation of apoptosis; regulation of cell cycle; regulation of cell proliferation; regulation of intracellular pH; regulation of neuron apoptosis; regulation of tissue remodeling; regulation of transcription from RNA polymerase II promoter; regulation of transcription, DNA-dependent; release of cytochrome c from mitochondria; response to DNA damage stimulus; response to drug; response to gamma radiation; response to oxidative stress; response to salt stress; response to UV; response to X-ray; rhythmic process; rRNA transcription; somitogenesis; T cell differentiation in the thymus; T cell lineage commitment; T cell proliferation during immune response; transcription, DNA-dependent; transforming growth factor beta receptor signaling pathway; viral reproduction

0.05 mg (E-Coli)

190 USD

0.2 mg (E-Coli)

460

0.5 mg (E-Coli)

750

0.05 mg (Baculovirus)

1155

1 mg (E-Coli)

1180