Recombinant Macaca mulatta (Rhesus macaque) C-X-C chemokine receptor type 4 (CXCR4) | MyBioSource MBS963839 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Macaca mulatta (Rhesus macaque) C-X-C chemokine receptor type 4 (CXCR4)

catalog :

MBS963839

quantity :

1 mg (E-Coli)

price :

1725 USD

product information

catalog number :

MBS963839

products type :

Recombinant Protein

products full name :

Recombinant Macaca mulatta (Rhesus macaque) C-X-C chemokine receptor type 4 (CXCR4)

products short name :

(Rhesus macaque) C-X-C chemokine receptor type 4 (CXCR4)

products name syn :

Recombinant (Rhesus macaque) C-X-C chemokine receptor type 4 (CXCR4); C-X-C chemokine receptor type 4; CXC-R4; CXCR-4; Fusin Leukocyte-derived seven transmembrane domain receptor; LESTR Stromal cell-derived factor 1 receptor; SDF-1 receptor CD_antigen= CD

other names :

C-X-C chemokine receptor type 4; C-X-C chemokine receptor type 4; C-X-C chemokine receptor type 4; LESTR; fusin; CXC-R4; CXCR-4; SDF-1 receptor; stromal cell-derived factor 1 receptor; leukocyte-derived seven transmembrane domain receptor; Fusin; Leukocyte-derived seven transmembrane domain receptor; LESTR; Stromal cell-derived factor 1 receptor

products gene name syn :

CXCR4

other gene names :

CXCR4; CXCR4; CXC-R4; CXCR-4; LESTR

uniprot entry name :

CXCR4_MACMU

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

1-352

sequence length :

352

sequence :

MEGISIYTSDNYTEEMGSGDYDSIKEPCFREENAHFNRI
FLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRL
HLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYT
VNLYSSVLILAFISLDRYLAIVHATNSQKPRKLLAEKVV
YVGVWIPALLLTIPDFIFASVSEADDRYICDRFYPNDLW
VVVFQFQHIMVGLILPGIDILSCYCIIISKLSHSKGHQK
RKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQG
CEFENTVHKWISITEALAFFHCCLNPILYAFLGAKFKTS
AQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHS
S

purity :

>90%

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

other info1 :

Species: Macaca mulatta (Rhesus macaque)

ncbi gi num :

111074564

ncbi acc num :

NP_001036110.1

ncbi gb acc num :

NM_001042645.1

uniprot acc num :

P79394

ncbi mol weight :

39,739 Da

ncbi pathways :

Axon Guidance Pathway (86735); Axon Guidance Pathway (476); Chemokine Signaling Pathway (99278); Chemokine Signaling Pathway (96864); Cytokine-cytokine Receptor Interaction Pathway (86721); Cytokine-cytokine Receptor Interaction Pathway (460); Endocytosis Pathway (102291); Endocytosis Pathway (102181); Intestinal Immune Network For IgA Production Pathway (128763); Intestinal Immune Network For IgA Production Pathway (128670)

uniprot summary :

Function: Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation. Acts as a receptor for extracellular ubiquitin; leading to enhanced intracellular calcium ions and reduced cellular cAMP levels. Involved in hematopoiesis and in cardiac ventricular septum formation. Also plays an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Involved in cerebellar development. In the CNS, could mediate hippocampal-neuron survival . By similarity. Subunit structure: Monomer . By similarity. Can form dimers . By similarity. Interacts with CD164. Interacts with ARRB2; the interaction is dependent on the C-terminal phosphorylation of CXCR4 and allows activation of MAPK1 and MAPK3. Interacts with ARRC; the interaction is dependent on the C-terminal phosphorylation of CXCR4 and modulates calcium mobilization. Interacts (via the cytoplasmic C-terminal) with ITCH (via the WW domains I and II); the interaction, enhanced by CXCL12, ubiquitinates CXCR4 and leads to its degradation. Interacts with extracellular ubiquitin; the interaction enhances intracellular calcium ions and reduces cellular cAMP levels . By similarity. Subcellular location: Cell membrane; Multi-pass membrane protein . By similarity. Note: In unstimulated cells, diffuse pattern on plasma membrane. On agonist stimulation, colocalizes with ITCH at the plasma membrane where it becomes ubiquitinated . By similarity. Post-translational modification: Phosphorylated on agonist stimulation. Rapidly phosphorylated on serine and threonine residues in the C-terminal. Phosphorylation at Ser-324 and Ser-325 leads to recruitment of ITCH, ubiquitination and protein degradation . By similarity.Ubiquitinated by ITCH at the cell membrane on agonist stimulation. The ubiquitin-dependent mechanism, endosomal sorting complex required for transport (ESCRT), then targets CXCR4 for lysosomal degradation. This process is dependent also on prior Ser-/Thr-phosphorylation in the C-terminal of CXCR4. Also binding of ARRB1 to STAM negatively regulates CXCR4 sorting to lysosomes though modulating ubiquitination of SFR5S . By similarity.Sulfation is required for efficient binding of CXCL12/SDF-1alpha and promotes its dimerization . By similarity.O- and N-glycosylated. N-glycosylation can mask coreceptor function. The O-glycosylation chondroitin sulfate attachment does not affect interaction with CXCL12/SDF-1alpha nor its coreceptor activity . By similarity. Sequence similarities: Belongs to the G-protein coupled receptor 1 family.

size1 :

1 mg (E-Coli)

price1 :

1725 USD

size2 :

1 mg (Yeast)

price2 :

2180