catalog number :
MBS963769
products type :
Recombinant Protein
products full name :
Recombinant Mouse Sex-determining region Y protein
products short name :
Sex-determining region Y protein
products name syn :
Testis-determining factor
other names :
sex-determining region Y protein; Sex-determining region Y protein; sex-determining region Y protein; sex determining region of Chr Y; Testis-determining factor
products gene name syn :
Tdf; Tdy
other gene names :
Sry; Sry; Tdf; Tdy; Tdf; Tdy
uniprot entry name :
SRY_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-144
sequence :
MEGHVKRPMNAFMVWSRGERHKLAQQNPSMQNTEISKQL
GCRWKSLTEAEKRPFFQEAQRLKILHREKYPNYKYQPHR
RAKVSQRSGILQPAVASTKLYNLLQWDRNPHAITYRQDW
SRAAHLYSKNQQSFYWQPVDIPTGHLQ
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Transcriptional regulator that controls a genetic switch in male development. It is necessary and sufficient for initiating male sex determination by directing the development of supporting cell precursors (pre-Sertoli cells) as Sertoli rather than granulosa cells. In male adult brain involved in the maintenance of motor functions of dopaminergic neurons. Involved in different aspects of gene regulation including promoter activation or repression. SRY HMG box recognizes DNA by partial intercalation in the minor groove. Promotes DNA bending. Also involved in pre-mRNA splicing. Binds to the DNA consensus sequence 5'-[AT]AACAA[AT]-3'. 1 Publication
products references :
Inverted repeat structure of the Sry locus in mice.Gubbay J., Vivian N., Economou A., Jackson D., Goodfellow P.Proc. Natl. Acad. Sci. U.S.A. 89:7953-7957(1992)
Rapid evolution of the sex determining locus in Old World mice and rats.Tucker P.K., Lundrigan B.L.Nature 364:715-717(1993)
Polymorphism of a CAG trinucleotide repeat within Sry correlates with B6.YDom sex reversal.Coward P., Nagai K., Chen D., Thomas H.D., Nagamine C.M., Lau Y.-F.C.Nat. Genet. 6:245-250(1994)
A gene mapping to the sex-determining region of the mouse Y chromosome is a member of a novel family of embryonically expressed genes.Gubbay J., Collignon J., Koopman P., Capel B., Economou A., Munsterberg A., Vivian N., Goodfellow P., Lovell-Badge R.Nature 346:245-250(1990)
Definition of a consensus DNA binding site for SRY.Harley V.R., Lovell-Badge R., Goodfellow P.N.Nucleic Acids Res. 22:1500-1501(1994)
Distinct DNA-binding properties of the high mobility group domain of murine and human SRY sex-determining factors.Giese K., Pagel J., Grosschedl R.Proc. Natl. Acad. Sci. U.S.A. 91:3368-3372(1994)
Expression of Sry, the mouse sex determining gene.Hacker A., Capel B., Goodfellow P., Lovell-Badge R.Development 121:1603-1614(1995)
Expression of a linear Sry transcript in the mouse genital ridge.Jeske Y.W., Bowles J., Greenfield A., Koopman P.Nat. Genet. 10:480-482(1995)
Developmental profile of Sry transcripts in mouse brain.Mayer A., Mosler G., Just W., Pilgrim C., Reisert I.Neurogenetics 3:25-30(2000)
Evidence that Sry is expressed in pre-Sertoli cells and Sertoli and granulosa cells have a common precursor.Albrecht K.H., Eicher E.M.Dev. Biol. 240:92-107(2001)
The C-terminal nuclear localization signal of the sex-determining region Y (SRY)
high mobility group domain mediates nuclear import through importin beta 1.Forwood J.K., Harley V., Jans D.A.J. Biol. Chem. 276:46575-46582(2001)
Sry-directed sex reversal in transgenic mice is robust with respect to enhanced DNA bending
comparison of human and murine HMG boxes.Phillips N.B., Nikolskaya T., Jancso-Radek A., Ittah V., Jiang F., Singh R., Haas E., Weiss M.A.Biochemistry 43:7066-7081(2004)
Regulation of human SRY subcellular distribution by its acetylation/deacetylation.Thevenet L., Mejean C., Moniot B., Bonneaud N., Galeotti N., Aldrian-Herrada G., Poulat F., Berta P., Benkirane M., Boizet-Bonhoure B.EMBO J. 23:3336-3345(2004)
Sry associates with the heterochromatin protein 1 complex by interacting with a KRAB domain protein.Oh H.J., Li Y., Lau Y.-F.C.Biol. Reprod. 72:407-415(2005)
NHERF2/SIP-1 interacts with mouse SRY via a different mechanism than human SRY.Thevenet L., Albrecht K.H., Malki S., Berta P., Boizet-Bonhoure B., Poulat F.J. Biol. Chem. 280:38625-38630(2005)
Direct regulation of adult brain function by the male-specific factor SRY.Dewing P., Chiang C.W., Sinchak K., Sim H., Fernagut P.-O., Kelly S., Chesselet M.-F., Micevych P.E., Albrecht K.H., Harley V.R., Vilain E.Curr. Biol. 16:415-420(2006)
The poly(ADP-ribose)
polymerase 1 interacts with Sry and modulates its biological functions.Li Y., Oh H.J., Lau Y.-F.C.Mol. Cell. Endocrinol. 257:35-46(2006)
Sry and the hesitant beginnings of male development.Polanco J.C., Koopman P.Dev. Biol. 302:13-24(2007)
KRAB
a partner for SRY action on chromatin.Oh H.J., Lau Y.F.Mol. Cell. Endocrinol. 247:47-52(2006)
ncbi acc num :
NP_035694.1
ncbi gb acc num :
NM_011564.1
ncbi pathways :
Androgen Receptor Signaling Pathway (198319); Deactivation Of The Beta-catenin Transactivating Complex Pathway (1324764); Signal Transduction Pathway (1324550); Signaling By Wnt Pathway (1324755); TCF Dependent Signaling In Response To WNT Pathway (1324760)
uniprot summary :
SRY: Transcriptional regulator that controls a genetic switch in male development. It is necessary and sufficient for initiating male sex determination by directing the development of supporting cell precursors (pre-Sertoli cells) as Sertoli rather than granulosa cells. In male adult brain involved in the maintenance of motor functions of dopaminergic neurons. Involved in different aspects of gene regulation including promoter activation or repression. Promotes DNA bending. SRY HMG box recognizes DNA by partial intercalation in the minor groove. Also involved in pre-mRNA splicing. Binds to the DNA consensus sequence 5'-[AT]AACAA[AT]-3'. Defects in SRY are the cause of 46,XY sex reversal type 1 (SRXY1). A condition characterized by male-to-female sex reversal in the presence of a normal 46,XY karyotype. Patients manifest rapid and early degeneration of their gonads, which are present in the adult as 'streak gonads', consisting mainly of fibrous tissue and variable amounts of ovarian stroma. As a result these patients do not develop secondary sexual characteristics at puberty. The external genitalia in these subjects are completely female, and Muellerian structures are normal. A 45,X chromosomal aberration involving SRY is found in Turner syndrome, a disease characterized by gonadal dysgenesis with short stature, streak gonads, variable abnormalities such as webbing of the neck, cubitus valgus, cardiac defects, low posterior hair line. The phenotype is female. Defects in SRY are the cause of 46,XX sex reversal type 1 (SRXX1). A condition in which male gonads develop in a genetic female (female to male sex reversal). Belongs to the SRY family. Protein type: DNA-binding; Nuclear receptor co-regulator. Cellular Component: cytoplasm; nucleus. Molecular Function: calmodulin binding; DNA bending activity; DNA binding; protein binding; protein heterodimerization activity; transcription factor activity. Biological Process: cell differentiation; male gonad development; male sex determination; negative regulation of transcription from RNA polymerase II promoter; regulation of transcription, DNA-dependent; sex determination; sex differentiation; transcription, DNA-dependent