product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Rat Regenerating islet-derived protein 3-gamma
catalog :
MBS963651
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS963651
products type :
Recombinant Protein
products full name :
Recombinant Rat Regenerating islet-derived protein 3-gamma
products short name :
Regenerating islet-derived protein 3-gamma
products name syn :
Pancreatitis-associated protein 3; Regenerating islet-derived protein III-gamma; Reg III-gamma
other names :
regenerating islet-derived protein 3-gamma; Regenerating islet-derived protein 3-gamma; regenerating islet-derived protein 3-gamma; regenerating family member 3 gamma; Pancreatitis-associated protein 3; Regenerating islet-derived protein III-gamma; Reg III-gamma
products gene name :
Reg3g
other gene names :
Reg3g; Reg3g; Pap3; PAPIII; Pap3; REG-3-gamma; Reg III-gamma
uniprot entry name :
REG3G_RAT
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
27-174
sequence length :
174
sequence :
EDAKEDVPTSRISCPKGSRAYGSYCYALFSVSKSWFDAD
LACQKRPSGHLVSVLSGSEASFVSSLIKSSGNSGQNVWI
GLHDPTLGQEPNRGGWEWSNADVMNYFNWETNPSSVSGS
HCGTLTRASGFLRWRENNCISELPYVCKFKA
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L. monocytogenes and methicillin-resistant S. aureus. Regulates keratinocyte proliferation and differentiation after skin injury.
products references :
The pancreatitis associated protein III (PAP III) , a new member of the PAP gene family.Frigerio J.-M., Dusetti N.J., Garrido P., Dagorn J.-C., Iovanna J.L.Biochim. Biophys. Acta 1216:329-331(1993) Cloning, expression and chromosomal localization of the rat pancreatitis-associated protein III gene.Dusetti N.J., Frigerio J.-M., Szpirer C., Dagorn J.-C., Iovanna J.L.Biochem. J. 307:9-16(1995) Reg3G gene expression in regenerating skeletal muscle and corresponding nerve.Klasan G.S., Ivanac D., Erzen D.J., Picard A., Takasawa S., Peharec S., Arbanas J., Girotto D., Jerkovic R.Muscle Nerve 49:61-68(2014)
ncbi gi num :
27465527
ncbi acc num :
NP_775120.1
ncbi gb acc num :
NM_173097.1
uniprot acc num :
P42854
ncbi mol weight :
20.34kD
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.05 mg (Yeast)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.2 mg (Yeast)
price4 :
460
size5 :
0.5 mg (Yeast)
price5 :
750
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!