catalog number :
MBS963608
products type :
Recombinant Protein
products full name :
Recombinant Mouse Protein S100-A9
products short name :
S100-A9
products name syn :
Calgranulin-B; Leukocyte L1 complex heavy chain; Migration inhibitory factor-related protein 14; MRP-14; p14; S100 calcium-binding protein A9
other names :
protein S100-A9; Protein S100-A9; protein S100-A9; S100 calcium binding protein A9 (calgranulin B); Calgranulin-B; Leukocyte L1 complex heavy chain; Migration inhibitory factor-related protein 14; MRP-14; p14; S100 calcium-binding protein A9
products gene name :
S100a9
other gene names :
S100a9; S100a9; p14; Cagb; GAGB; L1Ag; BEE22; MRP14; 60B8Ag; AW546964; Cagb; Mrp14; MRP-14; p14
uniprot entry name :
S10A9_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
2-113
sequence :
ANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQ
MVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEE
CMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
S100A9 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. It can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2 and can induce degranulation of neutrophils by a MAPK-dependent mechanism. Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions. The intracellular functions include: facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase. Activates NADPH-oxidase by facilitating the enzyme complex assembly at the cell membrane, transferring arachidonic acid, an essential cofactor, to the enzyme complex and S100A8 contributes to the enzyme assembly by directly binding to NCF2/P67PHOX. The extracellular functions involve proinfammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities. Its proinflammatory activity includes recruitment of leukocytes, promotion of cytokine and chokine production, and regulation of leukocyte adhesion and migration. Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER). Binding to TLR4 and AGER activates the MAP-kinase and NF-kappa-B signaling pathways resulting in the amplification of the proinflammatory cascade. Has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn2+ which is essential for microbial growth. Can induce cell death via autophagy and apoptosis and this occurs through the cross-talk of mitochondria and lysosomes via reactive oxygen species (ROS) and the process involves BNIP3. Can regulate neutrophil number and apoptosis by an anti-apoptotic effect; regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK. Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants. The iNOS-S100A8/A9 transnitrosylase complex is proposed to direct selective inflammatory stimulus-dependent S-nitrosylation of multiple targets such as GAPDH, NXA5, EZR, MSN and VIM by recognizing a [IL]-x-C-x-x-[DE] motif.
products references :
Mouse MRP8 and MRP14, two intracellular calcium-binding proteins associated with the development of the myeloid lineage.Lagasse E., Weissman I.L.Blood 79:1907-1915(1992)
Molecular analysis of the mouse S100A9 gene and evidence that the myeloid specific transcription factor C/EBPepsilon is not required for the regulation of the S100A9/A8 gene expression in neutrophils.Nacken W.K.F., Lekstrom-Himes J.A., Sorg C., Manitz M.3.0.CO;2-K>J. Cell. Biochem. 80:606-616(2001)
Isolation of the murine S100 protein MRP14 (14 kDa migration-inhibitory-factor-related protein)
from activated spleen cells
characterization of post-translational modifications and zinc binding.Raftery M.J., Harrison C.A., Alewood P.F., Jones A., Geczy C.L.Biochem. J. 316:285-293(1996)
Loss of S100A9 (MRP14)
results in reduced interleukin-8-induced CD11b surface expression, a polarized microfilament system, and diminished responsiveness to chemoattractants in vitro.Manitz M.-P., Horst B., Seeliger S., Strey A., Skryabin B.V., Gunzer M., Frings W., Schoenlau F., Roth J., Sorg C., Nacken W.Mol. Cell. Biol. 23:1034-1043(2003)
MRP8 and MRP14 control microtubule reorganization during transendothelial migration of phagocytes.Vogl T., Ludwig S., Goebeler M., Strey A., Thorey I.S., Reichelt R., Foell D., Gerke V., Manitz M.P., Nacken W., Werner S., Sorg C., Roth J.Blood 104:4260-4268(2004)
Comprehensive identification of phosphorylation sites in postsynaptic density preparations.Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L.Mol. Cell. Proteomics 5:914-922(2006)
Mrp8 and Mrp14 are endogenous activators of Toll-like receptor 4, promoting lethal, endotoxin-induced shock.Vogl T., Tenbrock K., Ludwig S., Leukert N., Ehrhardt C., van Zoelen M.A.D., Nacken W., Foell D., van der Poll T., Sorg C., Roth J.Nat. Med. 13:1042-1049(2007)
S100A8 and S100A9 mediate endotoxin-induced cardiomyocyte dysfunction via the receptor for advanced glycation end products.Boyd J.H., Kan B., Roberts H., Wang Y., Walley K.R.Circ. Res. 102:1239-1246(2008)
Anti-infective protective properties of S100 calgranulins.Hsu K., Champaiboon C., Guenther B.D., Sorenson B.S., Khammanivong A., Ross K.F., Geczy C.L., Herzberg M.C.Antiinflamm. Antiallergy Agents Med. Chem. 8:290-305(2009)
Identification of human S100A9 as a novel target for treatment of autoimmune disease via binding to quinoline-3-carboxamides.Bjoerk P., Bjoerk A., Vogl T., Stenstroem M., Liberg D., Olsson A., Roth J., Ivars F., Leanderson T.PLoS Biol. 7:E97-E97(2009)
Inflammation-associated S100 proteins
new mechanisms that regulate function.Goyette J., Geczy C.L.Amino Acids 41:821-842(2011)
S100A9 differentially modifies phenotypic states of neutrophils, macrophages, and dendritic cells
implications for atherosclerosis and adipose tissue inflammation.Averill M.M., Barnhart S., Becker L., Li X., Heinecke J.W., Leboeuf R.C., Hamerman J.A., Sorg C., Kerkhoff C., Bornfeldt K.E.Circulation 123:1216-1226(2011)
Induction of nuclear factor-kappaB responses by the S100A9 protein is Toll-like receptor-4-dependent.Riva M., Kaellberg E., Bjoerk P., Hancz D., Vogl T., Roth J., Ivars F., Leanderson T.Immunology 137:172-182(2012)
ncbi acc num :
NP_001268781.1
ncbi gb acc num :
NM_001281852.1
uniprot summary :
S100A9: a calcium-binding regulatory protein of the S-100 family expressed by macrophages in acutely inflammated tissues and in chronic inflammations. May be an inhibitor of protein kinases. Also expressed in epithelial cells constitutively or induced during dermatoses. May interact with components of the intermediate filaments in monocytes and epithelial cells. Interacts with CEACAM3 in a calcium-dependent manner. Protein type: Calcium-binding. Cellular Component: cytoplasm; cytoskeleton; extracellular region; extracellular space; membrane; nucleus; plasma membrane. Molecular Function: antioxidant activity; arachidonic acid binding; calcium ion binding; metal ion binding; microtubule binding; RAGE receptor binding; zinc ion binding. Biological Process: actin cytoskeleton reorganization; apoptosis; astrocyte development; autophagy; caspase activation; chemotaxis; immune system process; inflammatory response; innate immune response; leukocyte chemotaxis; leukocyte migration during inflammatory response; neutrophil chemotaxis; peptidyl-cysteine S-nitrosylation; positive regulation of blood coagulation; positive regulation of inflammatory response; positive regulation of peptide secretion; regulation of inflammatory response; regulation of integrin biosynthetic process; regulation of translation
size4 :
0.05 mg (Baculovirus)
size5 :
0.05 mg (Mammalian-Cell)