Recombinant Human Pulmonary surfactant-associated protein B (SFTPB) | MyBioSource MBS963591 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Pulmonary surfactant-associated protein B (SFTPB)

catalog :

MBS963591

quantity :

0.5 mg (E-Coli)

price :

810 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS963591

products type :

Recombinant Protein

products full name :

Recombinant Human Pulmonary surfactant-associated protein B (SFTPB)

products short name :

Pulmonary surfactant-associated protein B (SFTPB)

products name syn :

Pulmonary surfactant-associated protein B; SP-B; 18 kDa pulmonary-surfactant protein; 6 kDa protein; Pulmonary surfactant-associated proteolipid SPL(Phe)

other names :

pulmonary surfactant-associated protein B; Pulmonary surfactant-associated protein B; pulmonary surfactant-associated protein B; 6 kDa protein; 18 kDa pulmonary-surfactant protein; pulmonary surfactant-associated proteolipid SPL(Phe); surfactant protein B; 18 kDa pulmonary-surfactant protein; 6 kDa protein; Pulmonary surfactant-associated proteolipid SPL(Phe)

products gene name :

SFTPB

products gene name syn :

SFTPB; SFTP3

other gene names :

SFTPB; SFTPB; SP-B; PSP-B; SFTB3; SFTP3; SMDP1; SFTP3; SP-B

uniprot entry name :

PSPB_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

201-279; Mature full length protein.

sequence length :

279

sequence :

LLGRMLPQLVCRLVLRCSM
FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVP
LVAGGICQCLAERYSVILLDT

purity :

>90%

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

other info1 :

Species: Homo sapiens (Human)

products description :

Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.

ncbi gi num :

288856299

ncbi acc num :

NP_000533.3

ncbi gb acc num :

NM_000542.3

uniprot acc num :

P07988

ncbi mol weight :

13kD

ncbi pathways :

Focal Adhesion Pathway (83067); Focal Adhesion Pathway (478); MAPK Signaling Pathway (83048); MAPK Signaling Pathway (456); Salmonella Infection Pathway (375172); Salmonella Infection Pathway (375149)

ncbi summary :

This gene encodes the pulmonary-associated surfactant protein B (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% proteins which include plasma proteins and apolipoproteins SPA, SPB, SPC and SPD. The surfactant is secreted by the alveolar cells of the lung and maintains the stability of pulmonary tissue by reducing the surface tension of fluids that coat the lung. The SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Multiple mutations in this gene have been identified, which cause pulmonary surfactant metabolism dysfunction type 1, also called pulmonary alveolar proteinosis due to surfactant protein B deficiency, and are associated with fatal respiratory distress in the neonatal period. Alternatively spliced transcript variants encoding the same protein have been identified.[provided by RefSeq, Feb 2010]

uniprot summary :

SFTPB: Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air- liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter. Defects in SFTPB are the cause of pulmonary surfactant metabolism dysfunction type 1 (SMDP1); also called pulmonary alveolar proteinosis due to surfactant protein B deficiency. A rare lung disorder due to impaired surfactant homeostasis. It is characterized by alveolar filling with floccular material that stains positive using the periodic acid- Schiff method and is derived from surfactant phospholipids and protein components. Excessive lipoproteins accumulation in the alveoli results in severe respiratory distress. Genetic variations in SFTPB are a cause of susceptibility to respiratory distress syndrome in premature infants (RDS). RDS is a lung disease affecting usually premature newborn infants. It is characterized by deficient gas exchange, diffuse atelectasis, high-permeability lung edema and fibrin-rich alveolar deposits called hyaline membranes . A variation Ile to Thr at position 131 influences the association between specific alleles of SFTPA1 and respiratory distress syndrome in premature infants. Protein type: Secreted, signal peptide; Secreted. Chromosomal Location of Human Ortholog: 2p12-p11.2. Cellular Component: extracellular space; lysosome. Biological Process: organ morphogenesis; sphingolipid metabolic process; respiratory gaseous exchange. Disease: Surfactant Metabolism Dysfunction, Pulmonary, 1

size1 :

0.5 mg (E-Coli)

price1 :

810 USD

size2 :

0.05 mg (Baculovirus)

price2 :

810

size3 :

0.05 mg (Mammalian-Cell)

price3 :

1035

size4 :

0.5 mg (Yeast)

price4 :

1035

size5 :

1 mg (E-Coli)

price5 :

1125

more info or order :

MyBioSource product webpage