Recombinant Human Mitochondrial brown fat uncoupling protein 1 | MyBioSource MBS963514 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Mitochondrial brown fat uncoupling protein 1

catalog :

MBS963514

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS963514

products type :

Recombinant Protein

products full name :

Recombinant Human Mitochondrial brown fat uncoupling protein 1

products short name :

Mitochondrial brown fat uncoupling protein 1

products name syn :

Solute carrier family 25 member 7; Thermogenin

other names :

mitochondrial brown fat uncoupling protein 1; Mitochondrial brown fat uncoupling protein 1; mitochondrial brown fat uncoupling protein 1; uncoupling protein 1 (mitochondrial, proton carrier); Solute carrier family 25 member 7; Thermogenin

products gene name :

UCP1

other gene names :

UCP1; UCP1; UCP; SLC25A7; SLC25A7; UCP; UCP 1

uniprot entry name :

UCP1_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

2-307

sequence length :

307

sequence :

GGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVR
LQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLP
AGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKIL
AGLTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGT
YNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYD
LMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDV
VKTRFINSPPGQYKSVPNCAM

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Transport

products description :

UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat.

products references :

Human uncoupling protein gene structure, comparison with rat gene, and assignment to the long arm of chromosome 4.Cassard A.M., Bouillaud F., Mattei M.-G., Hentz E., Raimbault S., Thomas M., Ricquier D.J. Cell. Biochem. 43:255-264(1990) Bouillaud F.Sequence of the cDNA coding for the human uncoupling protein UCP.Bouillaud F., Ricquier D., Raimbault S. Generation and annotation of the DNA sequences of human chromosomes 2 and 4.Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.Nature 434:724-731(2005) Detection of brown adipose tissue uncoupling protein mRNA in adult patients by a human genomic probe.Bouillaud F., Villarroya F., Hentz E., Raimbault S., Cassard A.M., Ricquier D.Clin. Sci. 75:21-27(1988) A polymorphism in the 5' untranslated region and a Met229-->Leu variant in exon 5 of the human UCP1 gene are associated with susceptibility to type II diabetes mellitus.Mori H., Okazawa H., Iwamoto K., Maeda E., Hashiramoto M., Kasuga M.Diabetologia 44:373-376(2001) Uncoupling protein 1 and 3 polymorphisms are associated with waist-to-hip ratio.Herrmann S.M., Wang J.G., Staessen J.A., Kertmen E., Schmidt-Petersen K., Zidek W., Paul M., Brand E.J. Mol. Med. 81:327-332(2003)

ncbi gi num :

11225256

ncbi acc num :

NP_068605.1

ncbi gb acc num :

NM_021833.4

uniprot acc num :

P25874

ncbi mol weight :

48.9kD

ncbi pathways :

Adipogenesis Pathway (198832); Electron Transport Chain Pathway (198860); Huntington's Disease Pathway (83100); Huntington's Disease Pathway (512); Metabolism Pathway (1269956); Mitochondrial Uncoupling Proteins Pathway (1270130); PPAR Signaling Pathway (83042); PPAR Signaling Pathway (450); Respiratory Electron Transport, ATP Synthesis By Chemiosmotic Coupling, And Heat Production By Uncoupling Proteins. Pathway (1270127); The Citric Acid (TCA) Cycle And Respiratory Electron Transport Pathway (1270121)

ncbi summary :

Mitochondrial uncoupling proteins (UCP) are members of the family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed only in brown adipose tissue, a specialized tissue which functions to produce heat. [provided by RefSeq, Jul 2008]

uniprot summary :

UCP1: UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat. Belongs to the mitochondrial carrier family. Protein type: Mitochondrial; Membrane protein, multi-pass; Membrane protein, integral. Chromosomal Location of Human Ortholog: 4q28-q31. Cellular Component: integral to membrane; mitochondrial inner membrane; mitochondrion. Molecular Function: oxidative phosphorylation uncoupler activity; structural constituent of ribosome. Biological Process: brown fat cell differentiation; cellular metabolic process; mitochondrial transport; proton transport; regulation of transcription from RNA polymerase II promoter; translation. Disease: Obesity

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.05 mg (Yeast)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.2 mg (Yeast)

price4 :

460

size5 :

0.5 mg (E-Coli)

price5 :

750

more info or order :

MyBioSource product webpage