protein

Recombinant Human Type-1 angiotensin II receptor

MBS963402

INQUIRE

INQUIRE

Recombinant Protein

Recombinant Human Type-1 angiotensin II receptor

Type-1 angiotensin II receptor

AT1AR AT1BR Angiotensin II type-1 receptor; AT1

type-1 angiotensin II receptor isoform 1; Type-1 angiotensin II receptor; type-1 angiotensin II receptor; angiotensin II receptor type 1; AT1AR; AT1BR; Angiotensin II type-1 receptor; AT1

AGTR1

AGTR1; AGTR1; AT1; AG2S; AT1B; AT1R; AT1AR; AT1BR; AT2R1; HAT1R; AGTR1B; AGTR1A; AGTR1B; AT2R1; AT2R1B; AT1

AGTR1_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

297-359

359

LNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMS
TLSYRPSDNVSSSTKKPAPCFEVE

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Cancer

Receptor for angiotensin II. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.

Cloning, expression, and characterization of a gene encoding the human angiotensin II type 1A receptor.Mauzy C.A., Hwang O., Egloff A.M., Wu L.H., Chung F.-Z.Biochem. Biophys. Res. Commun. 186:277-284(1992) Molecular cloning and sequencing of the gene encoding human angiotensin II type 1 receptor.Furuta H., Guo D.F., Inagami T.Biochem. Biophys. Res. Commun. 183:8-13(1992) Cloning and characterization of a human angiotensin II type 1 receptor.Bergsma D.J., Ellis C., Kumar C., Nuthalaganti P., Kersten H., Elshourbagy N.A., Griffin E., Stadel J.M., Aiyar N.Biochem. Biophys. Res. Commun. 183:989-995(1992) Molecular cloning, sequence analysis and expression of a cDNA encoding human type-1 angiotensin II receptor.Takayanagi R., Ohnaka K., Sakai Y., Nakao R., Yanase T., Haji M., Inagami T., Furuta H., Gou D.F., Nakamuta M., Nawata H.Biochem. Biophys. Res. Commun. 183:910-916(1992) Genetic analysis of the human type-1 angiotensin II receptor.Curnow K.M., Pascoe L., White P.C.Mol. Endocrinol. 6:1113-1118(1992) Novel subtype of human angiotensin II type 1 receptor cDNA cloning and expression.Konishi H., Kuroda S., Inada Y., Fujisawa Y.Biochem. Biophys. Res. Commun. 199:467-474(1994) Type 1 angiotensin II receptors of adrenal tumors.Nawata H., Takayanagi R., Ohnaka K., Sakai Y., Imasaki K., Yanase T., Ikuyama S., Tanaka S., Ohe K.Steroids 60:28-34(1995) Cloning and sequencing of a human cDNA encoding the angiotensin II receptor type 1.Ostermann E., Castanon M.J. Rapid identification of polymorphisms in genomic DNA a high density SNP map of the type I angiotensin II receptor gene locus on chromosome 3q.Antonellis A., Rogus J.J., Pezzolesi M.G., Makita Y., Nam M., Doria A., Warram J.H., Krolewski A.S.cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org) .Kopatz S.A., Aronstam R.S., Sharma S.V. G-protein-coupled receptor Mas is a physiological antagonist of the angiotensin II type 1 receptor.Kostenis E., Milligan G., Christopoulos A., Sanchez-Ferrer C.F., Heringer-Walther S., Sexton P.M., Gembardt F., Kellett E., Martini L., Vanderheyden P., Schultheiss H.P., Walther T.Circulation 111:1806-1813(2005) A strategy for precise and large scale identification of core fucosylated glycoproteins.Jia W., Lu Z., Fu Y., Wang H.P., Wang L.H., Chi H., Yuan Z.F., Zheng Z.B., Song L.N., Han H.H., Liang Y.M., Wang J.L., Cai Y., Zhang Y.K., Deng Y.L., Ying W.T., He S.M., Qian X.H.Mol. Cell. Proteomics 8:913-923(2009) Mutations in genes in the renin-angiotensin system are associated with autosomal recessive renal tubular dysgenesis.Gribouval O., Gonzales M., Neuhaus T., Aziza J., Bieth E., Laurent N., Bouton J.M., Feuillet F., Makni S., Ben Amar H., Laube G., Delezoide A.-L., Bouvier R., Dijoud F., Ollagnon-Roman E., Roume J., Joubert M., Antignac C., Gubler M.-C.Nat. Genet. 37:964-968(2005)

4501997

NP_000676.1

NM_000685.4

P30556

9.2kD

ACE Inhibitor Pathway (198763); AGE-RAGE Signaling Pathway In Diabetic Complications (1319988); AGE-RAGE Signaling Pathway In Diabetic Complications (1319775); Adrenergic Signaling In Cardiomyocytes Pathway (908257); Adrenergic Signaling In Cardiomyocytes Pathway (909696); Aldosterone Synthesis And Secretion Pathway (1272485); Aldosterone Synthesis And Secretion Pathway (1285075); Angiopoietin Receptor Tie2-mediated Signaling Pathway (137917); Arf6 Signaling Events Pathway (138034); Calcium Signaling Pathway (83050)

Angiotensin II is a potent vasopressor hormone and a primary regulator of aldosterone secretion. It is an important effector controlling blood pressure and volume in the cardiovascular system. It acts through at least two types of receptors. This gene encodes the type 1 receptor which is thought to mediate the major cardiovascular effects of angiotensin II. This gene may play a role in the generation of reperfusion arrhythmias following restoration of blood flow to ischemic or infarcted myocardium. It was previously thought that a related gene, denoted as AGTR1B, existed; however, it is now believed that there is only one type 1 receptor gene in humans. Multiple alternatively spliced transcript variants have been reported for this gene. [provided by RefSeq, Jul 2012]

AT1: receptor for angiotensin II. Angiotensin II is a potent vasopressor hormone and a primary regulator of aldosterone secretion. It is an important effector controlling blood pressure and volume in the cardiovascular system. Mediates the major cardiovascular effects of angiotensin II. May play role in the generation of reperfusion arrhythmias following restoration of blood flow to ischemic or infarcted myocardium. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Protein type: GPCR, family 1; Membrane protein, integral; Receptor, GPCR; Membrane protein, multi-pass. Chromosomal Location of Human Ortholog: 3q24. Cellular Component: cytosol; integral to membrane; integral to plasma membrane; intracellular; plasma membrane. Molecular Function: angiotensin type I receptor activity; angiotensin type II receptor activity; bradykinin receptor binding; protein binding; protein heterodimerization activity. Biological Process: calcium-mediated signaling; elevation of cytosolic calcium ion concentration; elevation of cytosolic calcium ion concentration during G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); G-protein coupled receptor protein signaling pathway; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); kidney development; positive regulation of cellular protein metabolic process; positive regulation of inflammatory response; positive regulation of NAD(P)H oxidase activity; positive regulation of phospholipase A2 activity; regulation of cell growth; regulation of cell proliferation; regulation of inflammatory response; regulation of systemic arterial blood pressure by renin-angiotensin; regulation of vasoconstriction; regulation of vasodilation; renin-angiotensin regulation of aldosterone production; renin-angiotensin regulation of blood vessel size; Rho protein signal transduction. Disease: Hypertension, Essential; Renal Tubular Dysgenesis

INQUIRE

INQUIRE