catalog number :
MBS963387
products type :
Recombinant Protein
products full name :
Recombinant Macaca mulatta (Rhesus macaque) Cellular tumor antigen p53 (TP53)
products short name :
(Rhesus macaque) Cellular tumor antigen p53 (TP53)
other names :
cellular tumor antigen p53; Cellular tumor antigen p53; cellular tumor antigen p53; P53; tumor suppressor p53; Tumor suppressor p53
products gene name syn :
Recombinant (Rhesus macaque) Cellular tumor antigen p53 (TP53); Cellular tumor antigen p53; Tumor suppressor p53
other gene names :
TP53; TP53; P53
uniprot entry name :
P53_MACMU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-393
sequence :
MEEPQSDPSIEPPLSQETFSDLWKLLPENNVLSPLPSQA
VDDLMLSPDDLAQWLTEDPGPDEAPRMSEAAPPMAPTPA
APTPAAPAPAPSWPLSSSVPSQKTYHGSYGFRLGFLHSG
TAKSVTCTYSPDLNKMFCQLAKTCPVQLWVDSTPPPGSR
VRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLI
RVEGNLRVEYSDDRNTFRHSVVVPYEPPEVGSDCTTIHY
NYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVR
VCACPGRDRRTEEENFRKKGEPCHQLPPGSTKRALPNNT
SSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELK
DAQAGKEPAGSRAHSSHLKSKKGQSTSRHKKFMFKTEGP
DSD
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Species: Macaca mulatta (Rhesus macaque)
products description :
TP53; P53
ncbi acc num :
NP_001040616.1
ncbi gb acc num :
NM_001047151.2
ncbi mol weight :
43,655 Da
ncbi pathways :
Amyotrophic Lateral Sclerosis (ALS) Pathway (86769); Amyotrophic Lateral Sclerosis (ALS) Pathway (511); Apoptosis Pathway (86730); Apoptosis Pathway (470); Basal Cell Carcinoma Pathway (86779); Basal Cell Carcinoma Pathway (525); Bladder Cancer Pathway (86781); Bladder Cancer Pathway (527); Cell Cycle Pathway (86724); Cell Cycle Pathway (463)
uniprot summary :
Function: Acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. One of the activated genes is an inhibitor of cyclin-dependent kinases. Apoptosis induction seems to be mediated either by stimulation of BAX and FAS antigen expression, or by repression of Bcl-2 expression. Prevents CDK7 kinase activity when associated to CAK complex in response to DNA damage, thus stopping cell cycle progression. Induces the transcription of long intergenic non-coding RNA p21 (lincRNA-p21) and lincRNA-Mkln1. LincRNA-p21 participates in TP53-dependent transcriptional repression leading to apoptosis and seem to have to effect on cell-cycle regulation . By similarity. Cofactor: Binds 1 zinc ion per subunit . By similarity. Subunit structure: Binds DNA as a homotetramer. Found in a complex with CABLES1 and TP73. Interacts with histone acetyltransferases EP300 and methyltransferases HRMT1L2 and CARM1, and recruits them to promoters. The C-terminus interacts with TAF1, when TAF1 is part of the TFIID complex. Interacts with HIPK1, HIPK2, AXIN1, and TP53INP1. Part of a complex consisting of TP53, HIPK2 and AXIN1. Interacts with WWOX. Interacts with USP7 and SYVN1. Interacts with HSP90AB1. Interacts with ARMD10, BANP, CDKN2AIP, NUAK1, STK11/LKB1, UHRF2 and E4F1. Interacts with CHD8, leading to recruit histone H1 and prevent transactivation activity. Interacts with YWHAZ; the interaction enhances TP53 transcriptional activity. Phosphorylation of YWHAZ on 'Ser-58' inhibits this interaction. Directly interacts with FBXO42; leading to ubiquitination and degradation of TP53. Interacts with AURKA, DAXX, BRD7 and TRIM24. Interacts (when monomethylated at Lys-382) with L3MBTL1 . By similarity. Interacts with GRK5. Binds to the CAK complex (CDK7, cyclin H and MAT1) in response to DNA damage. Interacts with CDK5 in neurons. Interacts with AURKB, UHRF2 and NOC2L. Interacts (via N-terminus) with PTK2/FAK1; this promotes ubiquitination by MDM2. Interacts with PTK2B/PYK2; this promotes ubiquitination by MDM2 . By similarity. Interacts with PRKCG . By similarity. Subcellular location: Cytoplasm . By similarity. Nucleus . By similarity. Endoplasmic reticulum . By similarity. Note: Interaction with BANP promotes nuclear localization . By similarity. Domain: The [KR]-[STA]-K motif is specifically recognized by the SETD7 methyltransferase . By similarity. Post-translational modification: Acetylated. Its deacetylation by SIRT1 impairs its ability to induce proapoptotic program and modulate cell senescence . By similarity.Phosphorylation on Ser residues mediates transcriptional activation. Phosphorylation at Ser-9 by HIPK4 increases repression activity on BIRC5 promoter . By similarity. Phosphorylated on Thr-18 by VRK1, which may prevent the interaction with MDM2. Phosphorylated on Ser-20 by CHEK2 in response to DNA damage, which prevents ubiquitination by MDM2. Phosphorylated on Ser-20 by PLK3 in response to reactive oxygen species (ROS), promoting p53/TP53-mediated apoptosis. Phosphorylated on Thr-55 by TAF1 which promotes MDM2-mediated TP53 degradation. Phosphorylated on Ser-33 by CDK7 in a CAK complex in response to DNA damage. Phosphorylated by HIPK1. Phosphorylated on Ser-46 by HIPK2 upon UV irradiation. Phosphorylation on Ser-46 is required for acetylation by CREBBP. Phosphorylated on Ser-392 following UV but not gamma irradiation. Phosphorylated upon DNA damage, probably by ATM or ATR. Phosphorylated on Ser-15 upon ultraviolet irradiation; which is enhanced by interaction with BANP. Stabilized by CDK5-mediated phosphorylation in response to genotoxic and oxidative stresses at Ser-15, Ser-33 and Ser-46, leading to accumulation of p53/TP53, particularly in the nucleus, thus inducing the transactivation of p53/TP53 target genes. Phosphorylated at Ser-315 and Ser-392 by CDK2 in response to DNA-damage . By similarity.Ubiquitinated by MDM2 and SYVN1, which leads to proteasomal degradation. Ubiquitinated by RFWD3, which works in cooperation with MDM2 and may catalyze the formation of short polyubiquitin chains on p53/TP53 that are not targeted to the proteasome. Ubiquitinated by MKRN1 at Lys-291 and Lys-292, which leads to proteasomal degradation. Deubiquitinated by USP10, leading to stabilize it. Ubiquitinated by TRIM24, which leads to proteasomal degradation. Ubiquitination by TOPORS induces degradation. Deubiquitination by USP7, leading to stabilize it . By similarity.Monomethylated at Lys-372 by SETD7, leading to stabilization and increased transcriptional activation. Monomethylated at Lys-370 by SMYD2, leading to decreased DNA-binding activity and subsequent transcriptional regulation activity. Lys-372 monomethylation prevents interaction with SMYD2 and subsequent monomethylation at Lys-370. Dimethylated at Lys-373 by EHMT1 and EHMT2. Monomethylated at Lys-382 by SETD8, promoting interaction with L3MBTL1 and leading to repress transcriptional activity. Demethylation of dimethylated Lys-370 by KDM1A prevents interaction with TP53BP1 and represses TP53-mediated transcriptional activation . By similarity.Sumoylated with SUMO1 . By similarity. Involvement in disease: Note=p53 is found in increased amounts in a wide variety of transformed cells. p53 is frequently mutated or inactivated in many types of cancer. Sequence similarities: Belongs to the p53 family.