product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Macaca mulatta (Rhesus macaque) Protamine-2 (PRM2)
catalog :
MBS963360
quantity :
1 mg (E Coli Derived
price :
1150 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS963360
products type :
Recombinant Protein
products full name :
Recombinant Macaca mulatta (Rhesus macaque) Protamine-2 (PRM2)
products short name :
(Rhesus macaque) Protamine-2 (PRM2)
products name syn :
Recombinant (Rhesus macaque) Protamine-2 (PRM2); Protamine-2; Sperm histone P2 Sperm protamine P2
other names :
Protamine-2; Protamine-2; Sperm histone P2; Sperm protamine P2
products gene name syn :
PRM2
other gene names :
PRM2
uniprot entry name :
PRM2_MACMU
host :
E Coli or Yeast
sequence positions :
1-102
sequence length :
102
sequence :
MVRYRMRSLSERSHEVHGQQVHGQDQGHNGQEEQGLNPE
HVEVYERTHGHSHYRRRHCSRRRLHRIHRRRHRSCRRRR
RRSCRHRRRHRRGCRTRRRRCRRH
purity :
>90%
form :
This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Tag Information: His tagged (Host tag may vary. Please inquire for specific tag information). Species: Macaca mulatta (Rhesus macaque)
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
ncbi gi num :
462350
ncbi acc num :
P35297.1
uniprot acc num :
P35297
ncbi mol weight :
13,082 Da
ncbi pathways :
Focal Adhesion Pathway 83067!!Focal Adhesion Pathway 478!!MAPK Signaling Pathway 83048!!MAPK Signaling Pathway 456!!Salmonella Infection Pathway 375172!!Salmonella Infection Pathway 375149
uniprot summary :
Function: Protamines substitute for histones in the chromatin of sperm during the haploid phase of spermatogenesis. They compact sperm DNA into a highly condensed, stable and inactive complex. Subcellular location: Nucleus. Chromosome. Tissue specificity: Testis. Sequence similarities: Belongs to the protamine P2 family.
size :
1 mg (E Coli Derived)
price :
1150 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!