protein

Recombinant Human Methylenetetrahydrofolate reductase

MBS963336

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Human Methylenetetrahydrofolate reductase

Methylenetetrahydrofolate reductase

methylenetetrahydrofolate reductase; Methylenetetrahydrofolate reductase; methylenetetrahydrofolate reductase; methylenetetrahydrofolate reductase (NAD(P)H)

MTHFR

MTHFR; MTHFR

MTHR_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

1-656

656

MVNEARGNSSLNPCLEGSASSGSESSKDSSRCSTPGLDP
ERHERLREKMRRRLESGDKWFSLEFFPPRTAEGAVNLIS
RFDRMAAGGPLYIDVTWHPAGDPGSDKETSSMMIASTAV
NYCGLETILHMTCCRQRLEEITGHLHKAKQLGLKNIMAL
RGDPIGDQWEEEEGGFNYAVDLVKHIRSEFGDYFDICVA
GYPKGHPEAGSFEADLKHLKEKVSAGADFIITQLFFEAD
TFFRFVKACTDMGITCPIVPG

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Metabolism

Catalyzes the conversion of 5,10-methylenetetrahydrofolate to 5-methyltetrahydrofolate, a co-substrate for homocysteine rethylation to methionine.

cDNA for human methylenetetrahydrofolate reductase.Rozen R., Goyette P.Patent number WO9533054, 07-DEC-1995Gene structure of human and mouse methylenetetrahydrofolate reductase (MTHFR) .Goyette P., Pai A., Milos R., Frosst P., Tran P., Chen Z., Chan M., Rozen R.Mamm. Genome 9:652-656(1998) Revised translation initiation site of the human methylenetetrahydrofolate reductase (MTHFR) .Homberger A., Linnebank M., Winter C., Rapp B., Koch H.G.Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) NIEHS SNPs programThe DNA sequence and biological annotation of human chromosome 1.Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.Nature 441:315-321(2006)

87240000

NP_005948.3

NM_005957.4

P42898

90.55kD

Carbon Metabolism Pathway (814926); Carbon Metabolism Pathway (817567); Fluoropyrimidine Activity Pathway (198778); Folate Metabolism Pathway (198833); Folate-Alcohol And Cancer Pathway (920980); Metabolic Pathways (132956); Metabolism Pathway (1269956); Metabolism Of Folate And Pterines Pathway (1270156); Metabolism Of Vitamins And Cofactors Pathway (1270144); Metabolism Of Water-soluble Vitamins And Cofactors Pathway (1270145)

The protein encoded by this gene catalyzes the conversion of 5,10-methylenetetrahydrofolate to 5-methyltetrahydrofolate, a co-substrate for homocysteine remethylation to methionine. Genetic variation in this gene influences susceptibility to occlusive vascular disease, neural tube defects, colon cancer and acute leukemia, and mutations in this gene are associated with methylenetetrahydrofolate reductase deficiency.[provided by RefSeq, Oct 2009]

MTHFR: Catalyzes the conversion of 5,10- methylenetetrahydrofolate to 5-methyltetrahydrofolate, a co- substrate for homocysteine remethylation to methionine. Defects in MTHFR are the cause of methylenetetrahydrofolate reductase deficiency (MTHFRD). MTHFRD is autosomal recessive disorder with a wide range of features including homocysteinuria, homocysteinemia, developmental delay, severe mental retardation, perinatal death, psychiatric disturbances, and later-onset neurodegenerative disorders. Defects in MTHFR may be a cause of susceptibility to ischemic stroke (ISCHSTR); also known as cerebrovascular accident or cerebral infarction. A stroke is an acute neurologic event leading to death of neural tissue of the brain and resulting in loss of motor, sensory and/or cognitive function. Ischemic strokes, resulting from vascular occlusion, is considered to be a highly complex disease consisting of a group of heterogeneous disorders with multiple genetic and environmental risk factors. Defects in MTHFR may be a cause of susceptibility to folate-sensitive neural tube defects (FS-NTD). The most common NTDs are open spina bifida (myelomeningocele) and anencephaly. Belongs to the methylenetetrahydrofolate reductase family. Protein type: Energy Metabolism - methane; Oxidoreductase; Cofactor and Vitamin Metabolism - one carbon pool by folate; EC 1.5.1.20. Chromosomal Location of Human Ortholog: 1p36.3. Cellular Component: cytosol; neuron projection. Molecular Function: FAD binding; methylenetetrahydrofolate reductase (NADPH) activity; NADP binding; protein complex binding. Biological Process: amino acid metabolic process; blood circulation; folic acid metabolic process; homocysteine metabolic process; methionine biosynthetic process; methionine metabolic process; regulation of histone methylation; response to drug; response to folic acid; response to hypoxia; response to vitamin B2; S-adenosylmethionine metabolic process; vitamin metabolic process; water-soluble vitamin metabolic process. Disease: Homocystinuria Due To Deficiency Of N(5,10)-methylenetetrahydrofolate Reductase Activity; Neural Tube Defects, Folate-sensitive; Schizophrenia; Thrombophilia Due To Thrombin Defect

0.05 mg (E-Coli)

190 USD

0.05 mg (Yeast)

190

0.2 mg (E-Coli)

460

0.2 mg (Yeast)

460

0.5 mg (Yeast)

750