catalog number :
MBS963291
products type :
Recombinant Protein
products full name :
Recombinant Human Arylacetamide deacetylase (AADAC), partial
products short name :
[Arylacetamide deacetylase (AADAC)]
products name syn :
[Arylacetamide deacetylase; EC=3.1.1.3]
other names :
[arylacetamide deacetylase; Arylacetamide deacetylase; arylacetamide deacetylase; arylacetamide deacetylase (esterase); arylacetamide deacetylase]
products gene name :
[AADAC]
products gene name syn :
[AADAC; DAC]
other gene names :
[AADAC; AADAC; DAC; CES5A1; DAC]
uniprot entry name :
AAAD_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[24-399. Partial]
sequence :
PDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSF
KVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKSE
ALRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVV
VSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVN
PERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLI
YPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTD
RSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHV
YNNPNYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLT
YVITCQYDLLRDDGLMYVTRLRNTGVQVTHNHVEDGFHG
AFSFLGLKISHRLINQYIEWLKENL
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
image1 heading :
SDS-Page
other info1 :
Species: Homo sapiens (Human)
other info2 :
Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products description :
Displays cellular triglyceride lipase activity in liver, increases the levels of intracellular fatty acids derived from the hydrolysis of newly formed triglyceride stores and plays a role in very low-density lipoprotein assembly. Displays serine esterase activity in liver. Deacetylates a variety of arylacetamide substrates, including xenobiotic compounds and procarcinogens, converting them to the primary arylamide compounds and increasing their toxicity.
ncbi acc num :
NP_001077.2
ncbi gb acc num :
NM_001086.2
ncbi mol weight :
45,734 Da
ncbi summary :
Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens [provided by RefSeq, Jul 2008]
uniprot summary :
AADAC: Arylacetamide deacetylation is an important enzyme activity in the metabolic activation of arylamine substrates to ultimate carcinogens. Displays major serine hydrolase activity in liver microsomes. Hydrolyzes also flutamide, which is an antiandrogen drug used for the treatment of prostate cancer that occasionaly causes severe hepatotoxicity. Displays cellular triglyceride lipase activity in liver. Increases intracellular fatty acids derived from hydrolysis of newly formed triglyceride stores. Belongs to the GDXG lipolytic enzyme family. Protein type: Endoplasmic reticulum; Motility/polarity/chemotaxis; Membrane protein, integral; Deacetylase; EC 3.1.1.3; Lipase. Chromosomal Location of Human Ortholog: 3q25.1. Cellular Component: endoplasmic reticulum membrane; integral to membrane. Molecular Function: deacetylase activity; triacylglycerol lipase activity; serine hydrolase activity; lipase activity; catalytic activity. Biological Process: metabolic process
size7 :
0.05 mg (Baculovirus)
size10 :
0.05 mg (Mammalian-Cell)
size12 :
0.1 mg (Baculovirus)
size13 :
0.5 mg (Baculovirus)
size15 :
0.1 mg (Mammalian-Cell)
size16 :
1 mg (Baculovirus)