product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Rat Regenerating islet-derived protein 3-alpha
catalog :
MBS963283
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS963283
products type :
Recombinant Protein
products full name :
Recombinant Rat Regenerating islet-derived protein 3-alpha
products short name :
Regenerating islet-derived protein 3-alpha
products name syn :
Islet of Langerhans regenerating protein 3; REG 3; Lithostathine 3; Pancreatitis-associated protein 2; RegIII; Regenerating islet-derived protein III-alpha; Reg III-alpha
other names :
regenerating islet-derived protein 3-alpha; Regenerating islet-derived protein 3-alpha; regenerating islet-derived protein 3-alpha; regenerating islet-derived 3 alpha; Islet of Langerhans regenerating protein 3; REG 3
products gene name :
Reg3a
other gene names :
Reg3a; Reg3a; Pap2; PapII; Pap2; Reg3; REG-3-alpha; REG 3; Reg III-alpha
uniprot entry name :
REG3A_RAT
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
26-174
sequence length :
174
sequence :
EDSQKAVPSTRTSCPMGSKAYRSYCYTLVTTLKSWFQAD
LACQKRPSGHLVSILSGGEASFVSSLVTGRVNNNQDIWI
WLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNR
GNCGSLTATSEFLKWGDHHCDVELPFVCKFKQ
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Bactericidal C-type lectin. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway.
products references :
Identification of a second rat pancreatitis-associated protein. Messenger RNA cloning, gene structure, and expression during acute pancreatitis.Frigerio J.-M., Dusetti N.J., Keim V., Dagorn J.-C., Iovanna J.L.Biochemistry 32:9236-9241(1993) Structure and expression of a novel rat RegIII gene.Suzuki Y., Yonekura H., Watanabe T., Unno M., Moriizumi S., Miyashita H., Okamoto H.Gene 144:315-316(1994)
ncbi gi num :
224994175
ncbi acc num :
NP_001139318.1
ncbi gb acc num :
NM_001145846.2
uniprot acc num :
P35231
ncbi mol weight :
20.63kD
ncbi summary :
lectin-related secretory protein; overexpressed during the acute phase of pancreatitis [RGD, Feb 2006]
uniprot summary :
REG3A: Might be a stress protein involved in the control of bacterial proliferation. Protein type: Secreted; Secreted, signal peptide. Cellular Component: extracellular region. Molecular Function: carbohydrate binding. Biological Process: acute-phase response; negative regulation of keratinocyte differentiation
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
0.05 mg (Baculovirus)
price4 :
890
size5 :
0.05 mg (Mammalian-Cell)
price5 :
1115
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!