product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Lysyl oxidase homolog 1
catalog :
MBS963165
quantity :
0.05 mg (Yeast)
price :
185 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS963165
products type :
Recombinant Protein
products full name :
Recombinant Mouse Lysyl oxidase homolog 1
products short name :
Lysyl oxidase homolog 1
products name syn :
Lysyl oxidase 2; Lysyl oxidase-like protein 1
other names :
lysyl oxidase homolog 1; Lysyl oxidase homolog 1; lysyl oxidase homolog 1; lysyl oxidase-like 1; Lysyl oxidase 2; Lysyl oxidase-like protein 1
products gene name :
Loxl1
other gene names :
Loxl1; Loxl1; Loxl; Lox2; Loxl
uniprot entry name :
LOXL1_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
95-607
sequence length :
607
sequence :
RQAPSLPLPGRVGSDTVRGQTRHPFGFGQVPDNWREVAV
GDSTGMARARTSVSQQRHGGSASSSVSASAFATTYRQPS
PYPQQFPYPQAPFVNQYENYDPASRTYEQGYVYYRGAGG
GMGAGAAAVASAGVIYPFQPRARYEDYGGGGGEEQPEYP
AQGFYPAPERPYVPQPQPQPQPQPQPQPQPSDGLDRRYS
HSLYNEGTPGFEQAYPDPSTDVSQAPAGAGGTYGGAGDP
RLGWYPPYAANVPPEAYVPPR
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Active on elastin and collagen substrates.
products references :
Identification of the recombinant and natural forms of mature lysyl oxidase-like 1.Seve S., Borel A., Gleyzal C., Farjanel J., Eichenberger D., Font B., Sommer P. Genetic mapping of lysyl oxidase-2 (Loxl) on mouse chromosome 9.Tchernev V.T., Yang T.P., Kingsmore S.F.Mamm. Genome 8:621-622(1997) An intron capture strategy used to identify and map a lysyl oxidase-like gene on chromosome 9 in the mouse.Wydner K.S., Kim Y., Csiszar K., Boyd C.D., Passmore H.C.Genomics 40:342-345(1997)
ncbi gi num :
45598390
ncbi acc num :
NP_034859.2
ncbi gb acc num :
NM_010729.3
uniprot acc num :
P97873
ncbi mol weight :
60.52kD
ncbi pathways :
Assembly Of Collagen Fibrils And Other Multimeric Structures Pathway (1323912); Collagen Formation Pathway (1323910); Crosslinking Of Collagen Fibrils Pathway (1323914); Elastic Fibre Formation Pathway (1323916); Extracellular Matrix Organization Pathway (1323909)
uniprot summary :
LOXL1: Active on elastin and collagen substrates. Genetic variations in LOXL1 are a cause of susceptibility to exfoliation syndrome (XFS); also called exfoliation glaucoma (XFG). XFS is a disorder characterized by accumulation of abnormal fibrillar deposits in the anterior segment of the eye. In addition to being a cause of glaucoma and glaucomatous optic neuropathy, exfoliation syndrome has also been associated with lens zonule weakness, cataract formation, and systemic vascular complications due to deposition of exfoliation material in extraocular tissues. Susceptibility to exfoliation syndrome is conferred by a risk haplotype that includes two LOXL1 coding non-synonymous SNPs (Arg141Leu and Gly153Asp) and one intronic SNP. Arg141Leu and Gly153Asp are sufficient to confer disease susceptibility in some populations. Belongs to the lysyl oxidase family. Protein type: Extracellular matrix; Secreted, signal peptide; EC 1.4.3.-; Oxidoreductase; Secreted. Cellular Component: acrosome; basement membrane; cytoplasm; extracellular matrix; extracellular region; proteinaceous extracellular matrix. Molecular Function: aspartate oxidase activity; copper ion binding; metal ion binding; oxidoreductase activity; oxidoreductase activity, acting on the CH-NH2 group of donors, oxygen as acceptor; protein binding
size1 :
0.05 mg (Yeast)
price1 :
185 USD
size2 :
0.2 mg (Yeast)
price2 :
420
size3 :
0.5 mg (Yeast)
price3 :
680
size4 :
1 mg (Yeast)
price4 :
1070
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!