catalog number :
MBS963072
products type :
Recombinant Protein
products full name :
Recombinant Human U1 small nuclear ribonucleoprotein 70 kDa (SNRNP70)
products short name :
U1 small nuclear ribonucleoprotein 70 kDa (SNRNP70)
products name syn :
U1 small nuclear ribonucleoprotein 70 kDa; U1 snRNP 70 kDa; U1-70K; snRNP70
other names :
U1 small nuclear ribonucleoprotein 70 kDa isoform 1; U1 small nuclear ribonucleoprotein 70 kDa; U1 small nuclear ribonucleoprotein 70 kDa; U1 snRNP 70 kDa; small nuclear ribonucleoprotein 70kDa (U1)
products gene name :
SNRNP70
products gene name syn :
SNRNP70; RNPU1Z; RPU1; SNRP70; U1AP1
other gene names :
SNRNP70; SNRNP70; RPU1; Snp1; U1AP; U170K; U1RNP; RNPU1Z; SNRP70; U1-70K; RNPU1Z; RPU1; SNRP70; U1AP1; U1 snRNP 70 kDa; U1-70K; snRNP70
uniprot entry name :
RU17_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-210; Partial.
sequence :
MTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYC
GIAPYIREFEDPRDAPPPTRAETREERMERKRREKIERR
QQEVETELKMWDPHNDPNAQGDAFKTLFVARVNYDTTES
KLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERD
MHSAYKHADGKKIDGRRVLVDVERGRTVKGWRPRRLGGG
LGGTRRGGADVNIRH
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Homo sapiens (Human)
ncbi acc num :
NP_003080.2
ncbi gb acc num :
NM_003089.5
ncbi mol weight :
39,191 Da
ncbi pathways :
Gene Expression Pathway (105937); Processing Of Capped Intron-Containing Pre-mRNA Pathway (160950); Spliceosome Pathway (125136); Spliceosome Pathway (124832); Spliceosome, U1-snRNP Pathway (413435); MRNA Splicing Pathway (105951); MRNA Splicing - Major Pathway (105952); MRNA Processing Pathway (198843)
uniprot summary :
snRNP 70: mediates the splicing of pre-mRNA by binding to the loop I region of U1-snRNA. Participates in pre-mRNA splicing and exonic splicing complexes. A major ribonucleoprotein antigen recognized by the sera from patients with autoimmune diseases, such as systemic lupus erythematosus. Four alternatively spliced human isoforms have been described. The truncated isoforms (2-4) cannot bind U1-snRNA. Protein type: RNA-binding; Spliceosome; RNA splicing. Chromosomal Location of Human Ortholog: 19q13.3. Cellular Component: nucleoplasm; spliceosome; nuclear speck; snRNP U1; nucleus. Molecular Function: protein binding; RNA binding; nucleotide binding. Biological Process: positive regulation of nuclear mRNA splicing, via spliceosome; nuclear mRNA splicing, via spliceosome; regulation of RNA splicing; RNA splicing; gene expression; mRNA processing
size4 :
0.05 mg (Baculovirus)