protein

Recombinant Bovine Retinol-binding protein 3

MBS962924

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Bovine Retinol-binding protein 3

Retinol-binding protein 3

Interphotoreceptor retinoid-binding protein; IRBP; Interstitial retinol-binding protein

retinol-binding protein 3; Retinol-binding protein 3; retinol-binding protein 3; retinol binding protein 3; Interphotoreceptor retinoid-binding protein; IRBP; Interstitial retinol-binding protein

RBP3

RBP3; RBP3; IRBP; RBPI; RP66; D10S64; D10S65; D10S66; IRBP

RET3_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

633-1231

1247

AKVPTVLQTAGKLVADNYASPELGVKMAAELSGLQSRYA
RVTSEAALAELLQADLQVLSGDPHLKTAHIPEDAKDRIP
GIVPMQIPSPEVFEDLIKFSFHTNVLEGNVGYLRFDMFG
DCELLTQVSELLVEHVWKKIVHTDALIVDMRFNIGGPTS
SISALCSYFFDEGPPILLDKIYNRPNNSVSELWTLSQLE
GERYGSKKSMVILTSTLTAGAAEEFTYIMKRLGRALVIG
EVTSGGCQPPQTYHVDDTDLY

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

IRBP shuttles 11-cis and all trans retinoids between the retinol isomerase in the pigment epithelium and the visual pigments in the photoreceptor cells of the retina.

Human interstitial retinoid-binding protein. Gene structure and primary structure.Liou G.I., Ma D.-P., Yang Y.-W., Geng L., Zhu C., Baehr W.J. Biol. Chem. 264:8200-8206(1989) Characterization and comparative structural features of the gene for human interstitial retinol-binding protein.Fong S.-L., Fong W.B., Morris T.A., Kedzie K.M., Bridges C.D.B.J. Biol. Chem. 265:3648-3653(1990) Cloning of cDNAs encoding human interphotoreceptor retinoid-binding protein (IRBP) and comparison with bovine IRBP sequences.Si J.S., Borst D.E., Redmond T.M., Nickerson J.M.Gene 80:99-108(1989) Internal quadruplication in the structure of human interstitial retinol-binding protein deduced from its cloned cDNA.Fong S.-L., Bridges C.D.B.J. Biol. Chem. 263:15330-15334(1988) Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.Oshikawa M., Tsutsui C., Ikegami T., Fuchida Y., Matsubara M., Toyama S., Usami R., Ohtoko K., Kato S.Invest. Ophthalmol. Vis. Sci. 52:6662-6670(2011) The DNA sequence and comparative analysis of human chromosome 10.Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J., Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.Nature 429:375-381(2004)

4506453

NP_002891.1

NM_002900.2

P10745

59.8kD

Signal Transduction Pathway (1269379); The Canonical Retinoid Cycle In Rods (twilight Vision) Pathway (1269625); The Retinoid Cycle In Cones (daylight Vision) Pathway (1269626); Visual Phototransduction Pathway (1269623); The Visual Cycle I (vertebrates) Pathway (545451); The Visual Cycle I (vertebrates) Pathway (545294)

Interphotoreceptor retinol-binding protein is a large glycoprotein known to bind retinoids and found primarily in the interphotoreceptor matrix of the retina between the retinal pigment epithelium and the photoreceptor cells. It is thought to transport retinoids between the retinal pigment epithelium and the photoreceptors, a critical role in the visual process.The human IRBP gene is approximately 9.5 kbp in length and consists of four exons separated by three introns. The introns are 1.6-1.9 kbp long. The gene is transcribed by photoreceptor and retinoblastoma cells into an approximately 4.3-kilobase mRNA that is translated and processed into a glycosylated protein of 135,000 Da. The amino acid sequence of human IRBP can be divided into four contiguous homology domains with 33-38% identity, suggesting a series of gene duplication events. In the gene, the boundaries of these domains are not defined by exon-intron junctions, as might have been expected. The first three homology domains and part of the fourth are all encoded by the first large exon, which is 3,180 base pairs long. The remainder of the fourth domain is encoded in the last three exons, which are 191, 143, and approximately 740 base pairs long, respectively. [provided by RefSeq, Jul 2008]

RBP3: IRBP shuttles 11-cis and all trans retinoids between the retinol isomerase in the pigment epithelium and the visual pigments in the photoreceptor cells of the retina. Belongs to the peptidase S41A family. Protein type: Secreted, signal peptide; Secreted. Chromosomal Location of Human Ortholog: 10q11.2. Cellular Component: extracellular region; extracellular space. Molecular Function: retinal binding; retinoid binding; retinol binding; serine-type peptidase activity. Biological Process: lipid metabolic process; phototransduction, visible light; proteolysis; retinoid metabolic process; transport; visual perception. Disease: Retinitis Pigmentosa; Retinitis Pigmentosa 66

0.05 mg (E-Coli)

190 USD

0.05 mg (Yeast)

190

0.2 mg (E-Coli)

460

0.2 mg (Yeast)

460

0.5 mg (E-Coli)

750