product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Casein kinase I isoform alpha
catalog :
MBS962778
quantity :
0.05 mg (E-Coli)
price :
185 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS962778
products type :
Recombinant Protein
products full name :
Recombinant Human Casein kinase I isoform alpha
products short name :
Casein kinase I isoform alpha
products name syn :
CK1
other names :
casein kinase I isoform alpha isoform 1; Casein kinase I isoform alpha; casein kinase I isoform alpha; casein kinase 1 alpha 1; CK1
products gene name :
CSNK1A1
other gene names :
CSNK1A1; CSNK1A1; CK1; CK1a; CKIa; HLCDGP1; PRO2975; HEL-S-77p; CKI-alpha
uniprot entry name :
KC1A_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
2-337
sequence length :
365
sequence :
ASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNG
EEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWY
GQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLAD
QMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLID
FGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGI
EQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEK
ISEKKMSTPVEVLCKGFPAEF
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Cell Cycle
products description :
Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling. Phosphorylates CTNNB1 at 'Ser-45'. May phosphorylate PER1 and PER2. May play a role in segregating chromosomes during mitosis.
products references :
Cloning and chromosomal localization of the gene coding for human protein kinase CK1.Tapia C., Featherstone T., Gomez C., Taillon-Miller P., Allende C.C., Allende J.E.FEBS Lett. 349:307-312(1994)
ncbi gi num :
68303575
ncbi acc num :
NP_001020276.1
ncbi gb acc num :
NM_001025105.2
uniprot acc num :
P48729
ncbi mol weight :
42.9kD
ncbi pathways :
AMER1 Mutants Destabilize The Destruction Complex Pathway (1268913); APC Truncation Mutants Have Impaired AXIN Binding Pathway (1268909); AXIN Missense Mutants Destabilize The Destruction Complex Pathway (1268912); AXIN Mutants Destabilize The Destruction Complex, Activating WNT Signaling Pathway (1268910); Activation Of SMO Pathway (1269642); Beta-catenin Phosphorylation Cascade Pathway (1269597); Canonical Wnt Signaling Pathway (138032); Degradation Of GLI2 By The Proteasome Pathway (1269638); Degradation Of Beta-catenin By The Destruction Complex Pathway (1269596); Disassembly Of The Destruction Complex And Recruitment Of AXIN To The Membrane Pathway (1269601)
uniprot summary :
CK1A: an ubiquitous protein kinase of the CK1 family. Participates in Wnt signaling. Phosphorylates beta catenin, marking it for beta-TRCp-mediated ubiquitinylation and proteasomal degradation. Protein type: EC 2.7.11.1; Protein kinase, CK1; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; CK1 group; CK1 family. Chromosomal Location of Human Ortholog: 5q32. Cellular Component: beta-catenin destruction complex; centrosome; cytosol; keratin filament; membrane; mRNA cleavage and polyadenylation specificity factor complex; nuclear speck; ribonucleoprotein complex. Molecular Function: ATP binding; protein binding; protein kinase activity; protein serine/threonine kinase activity. Biological Process: cell division; cell morphogenesis; cell surface receptor linked signal transduction; Golgi organization and biogenesis; intermediate filament cytoskeleton organization and biogenesis; mitosis; peptidyl-serine phosphorylation; phagocytosis; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; protein amino acid phosphorylation; signal transduction; Wnt receptor signaling pathway
size1 :
0.05 mg (E-Coli)
price1 :
185 USD
size2 :
0.2 mg (E-Coli)
price2 :
420
size3 :
0.5 mg (E-Coli)
price3 :
680
size4 :
1 mg (E-Coli)
price4 :
1070
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!