This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MyBioSource
product type :
protein
product name :
Recombinant Bovine Diacylglycerol kinase alpha (DGKA) ,partial
catalog :
MBS962417
quantity :
1 mg (E Coli Derived
price :
1255 USD
product information
catalog number :
MBS962417
products type :
Recombinant Protein
products full name :
Recombinant Bovine Diacylglycerol kinase alpha (DGKA) ,partial
products short name :
Diacylglycerol kinase alpha(DGKA) ,partial
other names :
diacylglycerol kinase alpha; Diacylglycerol kinase alpha; diacylglycerol kinase alpha; DGK-alpha; DAG kinase alpha; diglyceride kinase alpha; diacylglycerol kinase, alpha 80kDa<; Diglyceride kinase alpha; DGK-alpha
products gene name :
DGKA
other gene names :
DGKA; DGKA; DAG kinase alpha; DGK-alpha
uniprot entry name :
DGKA_BOVIN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
317-505
sequence length :
505
sequence :
SNTHPLLVFVNPKSGGKQGERVLWKFQYLLNPRQVFNLL
KDGPEPGLRFFRDVPDYRILVCGGDGTVGWILESIDKAN
LPFVPPVAVLPLGTGNDLARCLRWGGGYEGQNLGKILKD
LETSKVVHMDRWSVEVIP
purity :
>90%
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info1 :
Tag Information: Diacylglycerol kinase catalytic domain; The E. coli version is tagged with N-terminal His-sumo-tag, and the other versions are tagged with N-terminal His-tag. (Host tag may vary. Please inquire for specific tag information). Species: Bos taurus (Bovine)
other info2 :
Storage Buffer: Tris-based buffer,50% glycerol. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
ncbi gi num :
118150836
ncbi acc num :
NP_001071328.1
ncbi gb acc num :
NM_001077860.1
uniprot acc num :
A0JN54
ncbi mol weight :
82,672 Da
ncbi pathways :
Effects Of PIP2 Hydrolysis Pathway 1008587!!G Alpha (q) Signalling Events Pathway 1008586!!GPCR Downstream Signaling Pathway 1008582!!Gastrin-CREB Signalling Pathway Via PKC And MAPK 1008603!!Glycerolipid Metabolism Pathway 84229!!Glycerolipid Metabolism Pathway 361!!Glycerophospholipid Metabolism Pathway 84232!!Glycerophospholipid Metabolism Pathway 364!!Hemostasis Pathway 1009046!!Metabolic Pathways 132940
size :
1 mg (E Coli Derived)
price :
1255 USD
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!