catalog number :
MBS962400
products type :
Recombinant Protein
products full name :
Recombinant Mouse Apolipoprotein C-III
products short name :
Apolipoprotein C-III
products name syn :
Apolipoprotein C3
other names :
apolipoprotein C-III isoform b; Apolipoprotein C-III; apolipoprotein C-III; apolipoprotein C-III; Apolipoprotein C3
products gene name :
Apoc3
other gene names :
Apoc3; Apoc3; apo-CIII; apoC-III; Apo-CIII; ApoC-III
uniprot entry name :
APOC3_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
21-99; Mature full length protein
sequence :
FTGFWDSNPEDQPTPAIES
EEVEGSLLLGSVQGYMEQASKTVQDALSSVQESDIAVVA
RGWMDNHFRFLKGYWSKFTDK
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors.
products references :
Characterization of the mouse apolipoprotein Apoa-1/Apoc-3 gene locus
genomic, mRNA, and protein sequences with comparisons to other species.Januzzi J.L., Azrolan N., O'Connell A., Aalto-Setala K., Breslow J.L.Genomics 14:1081-1088(1992)
Mass spectral analysis of the apolipoproteins on mouse high density lipoproteins. Detection of post-translational modifications.Puppione D.L., Yam L.M., Bassilian S., Souda P., Castellani L.W., Schumaker V.N., Whitelegge J.P.Biochim. Biophys. Acta 1764:1363-1371(2006)
ncbi acc num :
NP_001276685.1
ncbi gb acc num :
NM_001289756.1
ncbi pathways :
Chylomicron-mediated Lipid Transport Pathway (1324269); HDL-mediated Lipid Transport Pathway (1324270); Lipid Digestion, Mobilization, And Transport Pathway (1324265); Lipoprotein Metabolism Pathway (1324268); Metabolism Pathway (1324226); Metabolism Of Fat-soluble Vitamins Pathway (1324415); Metabolism Of Lipids And Lipoproteins Pathway (1324264); Metabolism Of Vitamins And Cofactors Pathway (1324401); PPAR (Peroxisome Proliferator-activated Receptor) Signaling Pathway (522983); PPAR Signaling Pathway (83239)
ncbi summary :
This gene encodes an apolipoprotein which is the major protein component of very-low-density lipoproteins (VLDL) and a minor component of high-density lipoproteins (HDL). The encoded protein is thought to regulate the metabolism of triglyceride-rich lipoproteins and play a role in lipid storage and the mobilization of fat cells. This gene is clustered with three other apolipoprotein genes on chromosome 9 and is associated with coronary disease. Mice lacking this gene have lower levels of total cholesterol in the plasma. Mutations in the human genes causes hyperalphalipoproteinemia 2, a disorder of lipid metabolism which results in a favorable lipid profile (lower LDL-cholesterol, higher HDL-cholesterol and lower levels of serum triglycerides when fasting and after a meal). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]
uniprot summary :
APOC3: Inhibits lipoprotein lipase and hepatic lipase and decreases the uptake of lymph chylomicrons by hepatic cells. This suggests that it delays the catabolism of triglyceride-rich particles. Defects in APOC3 are the cause of hyperalphalipoproteinemia type 2 (HALP2). HALP2 is a condition characterized by high levels of high density lipoprotein (HDL) and increased HDL cholesterol levels. Belongs to the apolipoprotein C3 family. Protein type: Secreted; Secreted, signal peptide; Lipid-binding. Cellular Component: cell; chylomicron; extracellular region; extracellular space. Molecular Function: lipase inhibitor activity; lipid binding; phospholipid binding. Biological Process: cholesterol homeostasis; cholesterol metabolic process; lipid catabolic process; lipid metabolic process; lipid transport; lipoprotein metabolic process; lipoprotein transport; negative regulation of lipoprotein lipase activity; response to peptide hormone stimulus; transport; triacylglycerol catabolic process; triacylglycerol metabolic process; triacylglycerol mobilization
size4 :
0.05 mg (Baculovirus)
size5 :
0.05 mg (Mammalian-Cell)