protein

Recombinant Rat Beta-2 adrenergic receptor (Adrb2)

MBS962378

INQUIRE

INQUIRE

Recombinant Protein

Recombinant Rat Beta-2 adrenergic receptor (Adrb2)

Beta-2 adrenergic receptor (Adrb2)

Recombinant Beta-2 adrenergic receptor (Adrb2); Beta-2 adrenergic receptor; Beta-2 adrenoreceptor; Beta-2 adrenoceptor

Beta-2 adrenergic receptor; Beta-2 adrenergic receptor; beta-2 adrenergic receptor; beta-2 adrenoceptor; beta-2 adrenoreceptor; adrenergic receptor, beta 2; Adrenergic beta 2- receptor surface; adrenergic, beta-2-, receptor, surface; adrenoceptor beta 2, surface; Beta-2 adrenoreceptor

Adrb2; Adrb2r

Adrb2; Adrb2; Adrb2r; Beta-2 adrenoceptor

ADRB2_RAT

E Coli or Yeast or Baculovirus or Mammalian Cell

330-418

PDFRIAFQELLCLRRSSSKTYGNGYSSNSNGRTDYTGEQ
SAYQLGQEKENELLCEEAPGMEGFVNCQGTVPSLSIDSQ
GRNCNTNDSPL

>90%(SDS-PAGE)

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C. For extended storage, store at -20 or -80 degree C. Note: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Species: Rattus norvegicus (Rat)

Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. The beta-2-adrenergic receptor binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine.

114768

P10608.1

P10608

27kD

Adrenoceptors Pathway (648911); Amine Ligand-binding Receptors Pathway (648909); CFTR Activity In The Plasma Membrane Pathway (198438); Calcium Regulation In The Cardiac Cell Pathway (198495); Calcium Signaling Pathway (83442); Calcium Signaling Pathway (459); Class A/1 (Rhodopsin-like Receptors) Pathway (648901); Endocytosis Pathway (102267); Endocytosis Pathway (102181); GPCR Ligand Binding Pathway (648900)

binds adrenergic receptor agonist zinterol; plays a role in G-protein coupled receptor regulation of calcium channel current [RGD, Feb 2006]

ADRB2: Beta-adrenergic receptors mediate the catecholamine- induced activation of adenylate cyclase through the action of G proteins. The beta-2-adrenergic receptor binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine. Belongs to the G-protein coupled receptor 1 family. Adrenergic receptor subfamily. ADRB2 sub-subfamily. Protein type: GPCR, family 1; Membrane protein, integral; Receptor, GPCR; Membrane protein, multi-pass. Cellular Component: intracellular membrane-bound organelle; integral to plasma membrane; dendrite; integral to membrane; dendritic spine; caveola; membrane; axon; apical plasma membrane; cytoplasm; plasma membrane; nucleus; endosome; sarcolemma; receptor complex. Molecular Function: protein homodimerization activity; G-protein alpha-subunit binding; norepinephrine binding; drug binding; epinephrine binding; PDZ domain binding; ionotropic glutamate receptor binding; protein binding; potassium channel regulator activity; enzyme binding; protein complex binding; dopamine binding; beta2-adrenergic receptor activity; B2 bradykinin receptor binding; adenylate cyclase binding. Biological Process: diet induced thermogenesis; wound healing; positive regulation of apoptosis; regulation of vasodilation; positive regulation of potassium ion transport; regulation of systemic arterial blood pressure by norepinephrine-epinephrine; female pregnancy; positive regulation of vasodilation; G-protein signaling, adenylate cyclase activating pathway; positive regulation of MAPKKK cascade; diaphragm contraction; negative regulation of smooth muscle contraction; positive regulation of cell proliferation; negative regulation of ossification; associative learning; aging; bone resorption; arrestin mediated desensitization of G-protein coupled receptor protein signaling pathway; regulation of smooth muscle contraction; synaptic transmission, glutamatergic; receptor-mediated endocytosis; negative regulation of multicellular organism growth; adenylate cyclase activation; regulation of calcium ion transport; response to testosterone stimulus; regulation of sodium ion transport; liver development; positive regulation of bone mineralization; G-protein coupled receptor protein signaling pathway; negative regulation of angiogenesis; positive regulation of the force of heart contraction by epinephrine; positive regulation of ATPase activity; response to estrogen stimulus; positive regulation of protein ubiquitination; negative regulation of inflammatory response; heat generation; brown fat cell differentiation; response to hypoxia; positive regulation of transcription from RNA polymerase II promoter; response to cold; regulation of sensory perception of pain; response to progesterone stimulus; positive regulation of skeletal muscle growth; regulation of excitatory postsynaptic membrane potential; positive regulation of heart contraction; norepinephrine-epinephrine vasodilation involved in regulation of systemic arterial blood pressure

INQUIRE

INQUIRE