protein

Recombinant Human Brain-derived neurotrophic factor protein

MBS962271

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Human Brain-derived neurotrophic factor protein

Brain-derived neurotrophic factor

Abrineurin

brain-derived neurotrophic factor isoform a preproprotein; Brain-derived neurotrophic factor; brain-derived neurotrophic factor; brain-derived neurotrophic factor; Abrineurin

BDNF

BDNF; BDNF; ANON2; BULN2; BDNF

BDNF_HUMAN

E Coli

137-237

247

ELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKG
QLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSY
VRALTMDSKKRIGWRFIRIDTSC

Greater than 90% as determined by SDS-PAGE.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Neuroscience

During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is phasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability.

Molecular cloning of a human gene that is a member of the nerve growth factor family.Jones K.R., Reichardt L.F.Proc. Natl. Acad. Sci. U.S.A. 87:8060-8064(1990) Human and rat brain-derived neurotrophic factor and neurotrophin-3 gene structures, distributions, and chromosomal localizations.Maisonpierre P.C., le Beau M.M., Espinosa R. III, Ip N.Y., Belluscio L., de la Monte S.M., Squinto S., Furth M.E., Yancopoulos G.D.Genomics 10:558-568(1991) Characterization of the 5'-flanking region of the human brain-derived neurotrophic factor gene.Shintani A., Ono Y., Kaisho Y., Igarashi K.Biochem. Biophys. Res. Commun. 182:325-332(1992) Human brain derived neurotrophic factor (BDNF) genes, splicing patterns, and assessments of associations with substance abuse and Parkinson's Disease.Liu Q.-R., Walther D., Drgon T., Polesskaya O., Lesnick T.G., Strain K.J., de Andrade M., Bower J.H., Maraganore D.M., Uhl G.R.Am. J. Med. Genet. B Neuropsychiatr. Genet. 134:93-103(2005) Dissecting the human BDNF locus bidirectional transcription, complex splicing, and multiple promoters.Pruunsild P., Kazantseva A., Aid T., Palm K., Timmusk T.Genomics 90:397-406(2007) A cDNA clone of human brain-derived neurotrophic factor (HUMBDNFD) .Cheng Y., Gu J.Wu J., Zhang B., Zhou Y., Peng X., Yuan J., Qiang B.Perez-Pinera P., Gonzalez-Martinez T., Garcia-Suarez O., Perez-Perez M., Esteban I., Monjil D., Vega J.A.Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G., Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006)

219842288

NP_001137277.1

NM_001143805.1

P23560

38.9kD

Alcoholism Pathway (585563); Alcoholism Pathway (587116); BDNF Signaling Pathway (712093); Cocaine Addiction Pathway (546258); Cocaine Addiction Pathway (546273); FSH Signaling Pathway (672455); Huntington's Disease Pathway (83100); Huntington's Disease Pathway (512); Integrated Pancreatic Cancer Pathway (711360); MAPK Signaling Pathway (198779)

This gene encodes a member of the nerve growth factor family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. Binding of this protein to its cognate receptor promotes neuronal survival in the adult brain. Expression of this gene is reduced in Alzheimer's, Parkinson's, and Huntington's disease patients. This gene may play a role in the regulation of the stress response and in the biology of mood disorders. [provided by RefSeq, Nov 2015]

BDNF: During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. Defects in BDNF are a cause of congenital central hypoventilation syndrome (CCHS); also known as congenital failure of autonomic control or Ondine curse. CCHS is a rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia. CCHS is frequently complicated with neurocristopathies such as Hirschsprung disease that occurs in about 16% of CCHS cases. Belongs to the NGF-beta family. 5 isoforms of the human protein are produced by alternative promoter. Protein type: Secreted, signal peptide; Cell development/differentiation; Cytokine; Secreted. Chromosomal Location of Human Ortholog: 11p13. Cellular Component: cytoplasm; cytoplasmic membrane-bound vesicle; extracellular region; perinuclear region of cytoplasm. Molecular Function: growth factor activity; neurotrophin TRKB receptor binding. Biological Process: axon extension; axon guidance; axon target recognition; behavioral fear response; brain-derived neurotrophic factor receptor signaling pathway; cell-cell signaling; collateral sprouting; dendrite development; feeding behavior; gamma-aminobutyric acid signaling pathway; glutamate secretion; inner ear development; learning and/or memory; mechanoreceptor differentiation; negative regulation of neuroblast proliferation; negative regulation of neuron apoptosis; negative regulation of synaptic transmission, GABAergic; nerve development; nervous system development; neuron recognition; positive regulation of brain-derived neurotrophic factor receptor signaling pathway; positive regulation of collateral sprouting; positive regulation of synaptogenesis; regulation of inhibitory postsynaptic membrane potential; regulation of metabolic process; regulation of retinal cell programmed cell death; regulation of synaptic plasticity; response to drug; synaptogenesis; ureteric bud development. Disease: Bulimia Nervosa, Susceptibility To, 1; Bulimia Nervosa, Susceptibility To, 2; Central Hypoventilation Syndrome, Congenital; Obsessive-compulsive Disorder

0.05 mg (E-Coli)

190 USD

0.2 mg (E-Coli)

460

0.5 mg (E-Coli)

750

1 mg (E-Coli)

1180