product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Macaca mulatta (Rhesus macaque) Interleukin-3 (IL3)
catalog :
MBS962187
quantity :
1 mg (E-Coli)
price :
1200 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS962187
products type :
Recombinant Protein
products full name :
Recombinant Macaca mulatta (Rhesus macaque) Interleukin-3 (IL3)
products short name :
(Rhesus macaque) Interleukin-3 (IL3)
products name syn :
Recombinant (Rhesus macaque) Interleukin-3 (IL3); Interleukin-3; IL-3; Hematopoietic growth factor Mast cell growth factor; MCGF Multipotential colony-stimulating factor P-cell-stimulating factor
other names :
interleukin-3; Interleukin-3; interleukin-3; IL-3; MCGF; mast cell growth factor; P-cell-stimulating factor; hematopoietic growth factor; multipotential colony-stimulating factor; Hematopoietic growth factor; Mast cell growth factor; MCGF; Multipotential colony-stimulating factor; P-cell-stimulating factor
products gene name syn :
IL3
other gene names :
IL3; IL3; IL-3; MCGF
uniprot entry name :
IL3_MACMU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
20-143
sequence length :
143
sequence :
APMTQTTSLKTSWAKCSNMIDEIITHLNQPPLPSPDFNN
LNEEDQTILVEKNLRRSNLEAFSKAVKSLQNASAIESIL
KNLPPCLPMATAAPTRPPIRITNGDRNDFRRKLKFYLKT
LENEQAQ
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Species: Macaca mulatta (Rhesus macaque)
ncbi gi num :
156119328
ncbi acc num :
NP_001095204.1
ncbi gb acc num :
NM_001101734.1
uniprot acc num :
P25140
ncbi mol weight :
16,087 Da
ncbi pathways :
Apoptosis Pathway (86730); Apoptosis Pathway (470); Asthma Pathway (86786); Asthma Pathway (532); Cytokine-cytokine Receptor Interaction Pathway (86721); Cytokine-cytokine Receptor Interaction Pathway (460); Fc Epsilon RI Signaling Pathway (86752); Fc Epsilon RI Signaling Pathway (493); Hematopoietic Cell Lineage Pathway (86748); Hematopoietic Cell Lineage Pathway (489)
uniprot summary :
Function: Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes. Subunit structure: Monomer. Subcellular location: Secreted. Tissue specificity: Activated T-cells, mast cells, natural killer cells. Sequence similarities: Belongs to the IL-3 family.
size1 :
1 mg (E-Coli)
price1 :
1200 USD
size2 :
1 mg (Yeast)
price2 :
1660
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!