Recombinant Macaca mulatta (Rhesus macaque) Inward rectifier potassium channel 2 (KCNJ2) | MyBioSource MBS961975 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Macaca mulatta (Rhesus macaque) Inward rectifier potassium channel 2 (KCNJ2)

catalog :

MBS961975

quantity :

1 mg (E-Coli)

price :

1895 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS961975

products type :

Recombinant Protein

products full name :

Recombinant Macaca mulatta (Rhesus macaque) Inward rectifier potassium channel 2 (KCNJ2)

products short name :

(Rhesus macaque) Inward rectifier potassium channel 2 (KCNJ2)

other names :

inward rectifier potassium channel 2; Inward rectifier potassium channel 2; inward rectifier potassium channel 2; IRK-1; inward rectifier K(+) channel Kir2.1; cardiac inward rectifier potassium channel; potassium channel, inwardly rectifying subfamily J member 2; Cardiac inward rectifier potassium channel; Inward rectifier K(+) channel Kir2.1; IRK-1; Potassium channel, inwardly rectifying subfamily J member 2

products gene name syn :

Recombinant (Rhesus macaque) Inward rectifier potassium channel 2 (KCNJ2); Inward rectifier potassium channel 2; Cardiac inward rectifier potassium channel Inward rectifier K(+) channel Kir2.1; IRK-1 Potassium channel, inwardly rectifying subfamily J member 2

other gene names :

KCNJ2; KCNJ2; IRK1; IRK1; IRK-1

uniprot entry name :

IRK2_MACMU

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

1-427

sequence length :

427

sequence :

MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHT
RQQCRSRFVKKDGHCNVQFINVGEKGQRYLADIFTTCVD
IRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLDASK
EGKACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPI
AVFMVVFQSIVGCIIDAFIIGAVMAKMAKPKKRNETLVF
SHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKS
RITSEGEYIPLDQIDINVGFDSGIDRIFLVSPITIVHEI
DEDSPLYDLSKQDIDNADFEIVVILEGMVEATAMTTQCR
SSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVP
NTPLCSARDLAEKKYILSNANSFCYENEVALTSKEEDDS
ENGVPESTSTDTPPDIDLHNQASVPLEPRPLRRESEI

purity :

>90%

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

other info1 :

Species: Macaca mulatta (Rhesus macaque)

products description :

KCNJ2; IRK1

ncbi gi num :

74136279

ncbi acc num :

NP_001028031.1

ncbi gb acc num :

NM_001032859.1

uniprot acc num :

P63253

ncbi mol weight :

48,288 Da

ncbi pathways :

Cholinergic Synapse Pathway (217718); Gastric Acid Secretion Pathway (154413); Gastric Acid Secretion Pathway (154383)

uniprot summary :

KCNJ2: Probably participates in establishing action potential waveform and excitability of neuronal and muscle tissues. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium or cesium. Defects in KCNJ2 are the cause of long QT syndrome type 7 (LQT7); also called Andersen syndrome or Andersen cardiodysrhythmic periodic paralysis. Long QT syndromes are heart disorders characterized by a prolonged QT interval on the ECG and polymorphic ventricular arrhythmias. They cause syncope and sudden death in response to excercise or emotional stress. LQT7 manifests itself as a clinical triad consisting of potassium-sensitive periodic paralysis, ventricular ectopy and dysmorphic features. Defects in KCNJ2 are the cause of short QT syndrome type 3 (SQT3). Short QT syndromes are heart disorders characterized by idiopathic persistently and uniformly short QT interval on ECG in the absence of structural heart disease in affected individuals. They cause syncope and sudden death. SQT3 has a unique ECG phenotype characterized by asymmetrical T waves. Defects in KCNJ2 are the cause of familial atrial fibrillation type 9 (ATFB9). ATFB9 is a familial form of atrial fibrillation, a common sustained cardiac rhythm disturbance. Atrial fibrillation is characterized by disorganized atrial electrical activity and ineffective atrial contraction promoting blood stasis in the atria and reduces ventricular filling. It can result in palpitations, syncope, thromboembolic stroke, and congestive heart failure. Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ2 subfamily. Protein type: Membrane protein, integral; Membrane protein, multi-pass; Channel, potassium. Chromosomal Location of Human Ortholog: 17q24.3. Cellular Component: Golgi apparatus; voltage-gated potassium channel complex; smooth endoplasmic reticulum; rough endoplasmic reticulum; cell soma; integral to plasma membrane; T-tubule; dendritic spine; plasma membrane; intrinsic to membrane. Molecular Function: identical protein binding; phosphatidylinositol-4,5-bisphosphate binding; inward rectifier potassium channel activity. Biological Process: synaptic transmission; regulation of skeletal muscle contraction via membrane action potential; potassium ion import; regulation of resting membrane potential; cellular potassium ion homeostasis; potassium ion transport; protein homotetramerization; magnesium ion transport. Disease: Atrial Fibrillation, Familial, 9; Andersen Cardiodysrhythmic Periodic Paralysis; Short Qt Syndrome 3

size1 :

1 mg (E-Coli)

price1 :

1895 USD

size2 :

1 mg (Yeast)

price2 :

2355

more info or order :

MyBioSource product webpage