product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Nuclear receptor ROR-gamma
catalog :
MBS961972
quantity :
0.05 mg (E-Coli)
price :
180 USD
more info or order :
product information
catalog number :
MBS961972
products type :
Recombinant Protein
products full name :
Recombinant Human Nuclear receptor ROR-gamma
products short name :
Nuclear receptor ROR-gamma
products name syn :
Nuclear receptor RZR-gamma; Nuclear receptor subfamily 1 group F member 3; RAR-related orphan receptor C; Retinoid-related orphan receptor-gamma
other names :
nuclear receptor ROR-gamma isoform b; Nuclear receptor ROR-gamma; nuclear receptor ROR-gamma; RAR related orphan receptor C; Nuclear receptor RZR-gamma; Nuclear receptor subfamily 1 group F member 3; RAR-related orphan receptor C; Retinoid-related orphan receptor-gamma
products gene name :
RORC
other gene names :
RORC; RORC; TOR; RORG; RZRG; NR1F3; RZR-GAMMA; NR1F3; RORG; RZRG
uniprot entry name :
RORG_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-518; Full length
sequence length :
518
sequence :
MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSS
GIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRT
SRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAE
VQKQLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDG
QLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGL
NGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFE
EHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHL
VQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKS
MWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIV
LLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRA
LGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAH
RPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPP
KGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFS
TETESPVGLSK
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Transcription
products description :
Nuclear receptor that binds DNA as a monomer to ROR response elements (RORE) containing a single core motif half-site 5'-AGGTCA-3' preceded by a short A-T-rich sequence. Key regulator of cellular differentiation, immunity, peripheral circadian rhythm as well as lipid, steroid, xenobiotics and glucose metabolism. Considered to have intrinsic transcriptional activity, have some natural ligands like oxysterols that act as agonists (25-hydroxycholesterol) or inverse agonists (7-oxygenated sterols), enhancing or repressing the transcriptional activity, respectively. Recruits distinct combinations of cofactors to target gene regulatory regions to modulate their transcriptional expression, depending on the tissue, time and promoter contexts. Regulates the circadian expression of clock genes such as CRY1, ARNTL/BMAL1 and NR1D1 in peripheral tissues and in a tissue-selective manner. Competes with NR1D1 for binding to their shared DNA response element on some clock genes such as ARNTL/BMAL1, CRY1 and NR1D1 itself, resulting in NR1D1-mediated repression or RORC-mediated activation of the expression, leading to the circadian pattern of clock genes expression. Therefore influences the period length and stability of the clock. Involved in the regulation of the rhythmic expression of genes involved in glucose and lipid metabolism, including PLIN2 and AVPR1A. Negative regulator of adipocyte differentiation through the regulation of early phase genes expression, such as MMP3. Controls adipogenesis as well as adipocyte size and modulates insulin sensitivity in obesity. In liver, has specific and redundant functions with RORA as positive or negative modulator of expression of genes encoding phase I and Phase II proteins involved in the metabolism of lipids, steroids and xenobiotics, such as SULT1E1. Also plays also a role in the regulation of hepatocyte glucose metabolism through the regulation of G6PC and PCK1. Regulates the rhythmic expression of PROX1 and promotes its nuclear localization.
products references :
ROR gamma the third member of ROR/RZR orphan receptor subfamily that is highly expressed in skeletal muscle.Hirose T., Smith R.J., Jetten A.M.Biochem. Biophys. Res. Commun. 205:1976-1983(1994) The full-ORF clone resource of the German cDNA consortium.Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.BMC Genomics 8:399-399(2007) The DNA sequence and biological annotation of human chromosome 1.Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.Nature 441:315-321(2006) TGF-beta-induced Foxp3 inhibits T(H) 17 cell differentiation by antagonizing RORgammat function.Zhou L., Lopes J.E., Chong M.M., Ivanov I.I., Min R., Victora G.D., Shen Y., Du J., Rubtsov Y.P., Rudensky A.Y., Ziegler S.F., Littman D.R.Nature 453:236-240(2008) Retinoid-related orphan receptors (RORs) critical roles in development, immunity, circadian rhythm, and cellular metabolism.Jetten A.M.Nucl. Recept. Signal. 7:3-35(2009) A second class of nuclear receptors for oxysterols Regulation of RORalpha and RORgamma activity by 24S-hydroxycholesterol (cerebrosterol) .Wang Y., Kumar N., Crumbley C., Griffin P.R., Burris T.P.Biochim. Biophys. Acta 1801:917-923(2010) Modulation of retinoic acid receptor-related orphan receptor alpha and gamma activity by 7-oxygenated sterol ligands.Wang Y., Kumar N., Solt L.A., Richardson T.I., Helvering L.M., Crumbley C., Garcia-Ordonez R.D., Stayrook K.R., Zhang X., Novick S., Chalmers M.J., Griffin P.R., Burris T.P.J. Biol. Chem. 285:5013-5025(2010) Adipogenesis and insulin sensitivity in obesity are regulated by retinoid-related orphan receptor gamma.Meissburger B., Ukropec J., Roeder E., Beaton N., Geiger M., Teupser D., Civan B., Langhans W., Nawroth P.P., Gasperikova D., Rudofsky G., Wolfrum C.EMBO Mol. Med. 3:637-651(2011) Suppression of TH17 differentiation and autoimmunity by a synthetic ROR ligand.Solt L.A., Kumar N., Nuhant P., Wang Y., Lauer J.L., Liu J., Istrate M.A., Kamenecka T.M., Roush W.R., Vidovic D., Schuerer S.C., Xu J., Wagoner G., Drew P.D., Griffin P.R., Burris T.P.Nature 472:491-494(2011) Cryptochromes mediate rhythmic repression of the glucocorticoid receptor.Lamia K.A., Papp S.J., Yu R.T., Barish G.D., Uhlenhaut N.H., Jonker J.W., Downes M., Evans R.M.Nature 480:552-556(2011) Action of RORs and their ligands in (patho) physiology.Solt L.A., Burris T.P.Trends Endocrinol. Metab. 23:619-627(2012) Structural basis for hydroxycholesterols as natural ligands of orphan nuclear receptor RORgamma.Jin L., Martynowski D., Zheng S., Wada T., Xie W., Li Y.Mol. Endocrinol. 24:923-929(2010)
ncbi gi num :
48255918
ncbi acc num :
NP_001001523.1
ncbi gb acc num :
NM_001001523.1
uniprot acc num :
P51449
ncbi mol weight :
74.2kD
ncbi pathways :
Circadian Rhythm Pathway (83084); Circadian Rhythm Pathway (495); Gene Expression Pathway (1269649); Generic Transcription Pathway (1269650); Inflammatory Bowel Disease (IBD) Pathway (842771); Inflammatory Bowel Disease (IBD) Pathway (842797); Nuclear Receptor Transcription Pathway (1269652); Nuclear Receptors Pathway (198848)
ncbi summary :
The protein encoded by this gene is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that this gene may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
uniprot summary :
RORC: Possible nuclear receptor for hydroxycholesterols, the binding of which strongly promotes coactivators recruitment. Essential for thymopoiesis and the development of several secondary lymphoid tissues, including lymph nodes. Involved in lineage specification of uncommitted CD4(+) T-helper cells into Th17 cells. Regulate the expression of several components of the circadian clock. Belongs to the nuclear hormone receptor family. NR1 subfamily. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Transcription factor; Nuclear receptor; DNA-binding. Chromosomal Location of Human Ortholog: 1q21. Cellular Component: intracellular membrane-bound organelle; nucleolus; nucleoplasm; nucleus. Molecular Function: DNA binding; ligand-dependent nuclear receptor activity; oxysterol binding; protein binding; sequence-specific DNA binding; steroid hormone receptor activity; transcription factor activity; zinc ion binding. Biological Process: circadian regulation of gene expression; gene expression; intracellular receptor-mediated signaling pathway; lymph node development; Peyer's patch development; positive regulation of circadian rhythm; positive regulation of transcription, DNA-dependent; regulation of fat cell differentiation; regulation of steroid metabolic process; steroid hormone mediated signaling; T-helper cell differentiation; transcription initiation from RNA polymerase II promoter; xenobiotic metabolic process. Disease: Immunodeficiency 42
size1 :
0.05 mg (E-Coli)
price1 :
180 USD
size2 :
0.05 mg (Yeast)
price2 :
260
size3 :
0.2 mg (E-Coli)
price3 :
490
size4 :
0.2 mg (Yeast)
price4 :
600
size5 :
0.5 mg (E-Coli)
price5 :
715
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!