product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Keratin, type I cytoskeletal 14
catalog :
MBS961967
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS961967
products type :
Recombinant Protein
products full name :
Recombinant Human Keratin, type I cytoskeletal 14
products short name :
Keratin, type I cytoskeletal 14
products name syn :
Cytokeratin-14; CK-14; Keratin-14; K14
other names :
keratin, type I cytoskeletal 14; Keratin, type I cytoskeletal 14; keratin, type I cytoskeletal 14; keratin 14, type I; Cytokeratin-14; CK-14; Keratin-14; K14
products gene name :
KRT14
other gene names :
KRT14; KRT14; K14; NFJ; CK14; EBS3; EBS4; CK-14; K14
uniprot entry name :
K1C14_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-472
sequence length :
472
sequence :
MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVLAGGS
CRAPSTYGGGLSVSSSRFSSGGACGLGGGYGGGFSSSSS
SFGSGFGGGYGGGLGAGLGGGFGGGFAGGDGLLVGSEKV
TMQNLNDRLASYLDKVRALEEANADLEVKIRDWYQRQRP
AEIKDYSPYFKTIEDLRNKILTATVDNANVLLQIDNARL
AADDFRTKYETELNLRMSVEADINGLRRVLDELTLARAD
LEMQIESLKEELAYLKKNHEE
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Signal Transduction
products description :
The nonhelical tail domain is involved in promoting KRT5-KRT14 filaments to self-organize into large bundles and enhances the mechanical properties involved in resilience of keratin intermediate filaments in vitro.
products references :
Remarkable conservation of structure among intermediate filament genes.Marchuk D., McCrohon S., Fuchs E.Cell 39:491-498(1984)
ncbi gi num :
15431310
ncbi acc num :
NP_000517.2
ncbi gb acc num :
NM_000526.4
uniprot acc num :
P02533
ncbi mol weight :
67.5kD
ncbi pathways :
Corticotropin-releasing Hormone Pathway (920957); Glucocorticoid Receptor Regulatory Network Pathway (138014)
ncbi summary :
This gene encodes a member of the keratin family, the most diverse group of intermediate filaments. This gene product, a type I keratin, is usually found as a heterotetramer with two keratin 5 molecules, a type II keratin. Together they form the cytoskeleton of epithelial cells. Mutations in the genes for these keratins are associated with epidermolysis bullosa simplex. At least one pseudogene has been identified at 17p12-p11. [provided by RefSeq, Jul 2008]
uniprot summary :
K14: a type I cytoskeletal keratin. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. There are two types of cytoskeletal and microfibrillar keratin: type I (acidic; 40-55 kDa) [K9 to K20] and type II (neutral to basic; 56-70 kDa) [K1 to K8]. Both a basic and an acidic keratin are required for filament assembly. Generally associates with K5. Protein type: Cytoskeletal. Chromosomal Location of Human Ortholog: 17q21.2. Cellular Component: cytoplasm; cytosol; intermediate filament; keratin filament; nucleus. Molecular Function: protein binding; structural constituent of cytoskeleton. Biological Process: aging; epidermis development; epithelial cell differentiation; hair cycle; hemidesmosome assembly; intermediate filament bundle assembly; response to ionizing radiation; response to zinc ion. Disease: Dermatopathia Pigmentosa Reticularis; Epidermolysis Bullosa Simplex, Autosomal Recessive 1; Epidermolysis Bullosa Simplex, Dowling-meara Type; Epidermolysis Bullosa Simplex, Generalized; Epidermolysis Bullosa Simplex, Localized; Naegeli Syndrome
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.05 mg (Yeast)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.2 mg (Yeast)
price4 :
460
size5 :
0.5 mg (Yeast)
price5 :
750
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!