product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Rat High mobility group protein B1 (Hmgb1)
catalog :
MBS961958
quantity :
0.05 mg (Yeast)
price :
260 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS961958
products type :
Recombinant Protein
products full name :
Recombinant Rat High mobility group protein B1 (Hmgb1)
products short name :
High mobility group protein B1 (Hmgb1)
products name syn :
High mobility group protein B1; Amphoterin; Heparin-binding protein p30; High mobility group protein 1; HMG-1
other names :
high mobility group protein B1; High mobility group protein B1; high mobility group protein B1; HMG-1; amphoterin; high mobility group 1; heparin-binding protein p30; high mobility group protein 1; high mobility group box 1; Amphoterin; Heparin-binding protein p30; High mobility group protein 1; HMG-1
products gene name :
Hmgb1
products gene name syn :
Hmgb1; Hmg-1; Hmg1
other gene names :
Hmgb1; Hmgb1; Hmg1; Ac2-008; Hmg-1; Hmg1; HMG-1
uniprot entry name :
HMGB1_RAT
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
2-215; Full length
sequence length :
215
sequence :
PKIKGEHPGL SIGDVAKKLG EMWNNTAADD KQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEE DDDDE
GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSE
FSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYI
PPKGETKKKFKDPNAPKRPPSAFFLFCSEYR
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Rattus norvegicus (Rat)
ncbi gi num :
6981026
ncbi acc num :
NP_037095.1
ncbi gb acc num :
NM_012963.2
uniprot acc num :
P63159
ncbi mol weight :
24,894 Da
ncbi pathways :
Base Excision Repair Pathway (83435); Base Excision Repair Pathway (451)
ncbi summary :
heparin binding protein that facilitates neurite outgrowth [RGD, Feb 2006]
uniprot summary :
HMGB1: DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Heparin-binding protein that has a role in the extension of neurite-type cytoplasmic processes in developing cells. Component of the RAG complex composed of core components RAG1 and RAG2, and associated component HMGB1 or HMGB2. Belongs to the HMGB family. Protein type: Nuclear receptor co-regulator; DNA repair, damage. Cellular Component: extracellular space; neuron projection; cytoplasm; nucleus. Molecular Function: crossed form four-way junction DNA binding; open form four-way junction DNA binding; cytokine activity; bent DNA binding; chromatin binding; protein kinase activator activity. Biological Process: positive regulation of myeloid cell differentiation; response to glucocorticoid stimulus; positive regulation of mitotic cell cycle; positive regulation of glycogen catabolic process; DNA geometric change; induction of positive chemotaxis; chromatin remodeling; eye development; positive regulation of protein kinase activity; positive regulation of mesenchymal cell proliferation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of protein amino acid phosphorylation; positive regulation of cell migration; lung development
size1 :
0.05 mg (Yeast)
price1 :
260 USD
size2 :
0.05 mg (E-Coli)
price2 :
305
size3 :
0.2 mg (Yeast)
price3 :
490
size4 :
0.2 mg (E-Coli)
price4 :
580
size5 :
0.05 mg (Baculovirus)
price5 :
950
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!