product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Macaca mulatta (Rhesus macaque) Synaptosomal-associated protein 25 (SNAP25)
catalog :
MBS961856
quantity :
1 mg (E-Coli)
price :
1390 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS961856
products type :
Recombinant Protein
products full name :
Recombinant Macaca mulatta (Rhesus macaque) Synaptosomal-associated protein 25 (SNAP25)
products short name :
(Rhesus macaque) Synaptosomal-associated protein 25 (SNAP25)
products name syn :
Recombinant (Rhesus macaque) Synaptosomal-associated protein 25 (SNAP25); Synaptosomal-associated protein 25; SNAP-25; Synaptosomal-associated 25 kDa protein
other names :
synaptosomal-associated protein 25; Synaptosomal-associated protein 25; synaptosomal-associated protein 25; synaptosomal-associated 25 kDa protein; synaptosomal-associated protein 25 isoform SNAP25B; Synaptosomal-associated 25 kDa protein
products gene name syn :
SNAP25
other gene names :
SNAP25; SNAP25; SNAP-25; SNAP-25
uniprot entry name :
SNP25_MACMU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-206
sequence length :
206
sequence :
MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEES
KDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNL
TDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQP
ARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGI
IGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEA
NQRATKMLGSG
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Species: Macaca mulatta (Rhesus macaque)
ncbi gi num :
74136289
ncbi acc num :
NP_001028036.1
ncbi gb acc num :
NM_001032864.1
uniprot acc num :
P60877
ncbi mol weight :
23,315 Da
ncbi pathways :
SNARE Interactions In Vesicular Transport Pathway (86727); SNARE Interactions In Vesicular Transport Pathway (467)
uniprot summary :
Function: t-SNARE involved in the molecular regulation of neurotransmitter release. May play an important role in the synaptic function of specific neuronal systems. Associates with proteins involved in vesicle docking and membrane fusion. Regulates plasma membrane recycling through its interaction with CENPF . By similarity. Subunit structure: Part of the SNARE core complex containing SNAP25, VAMP2 and STX1A. This complex binds CPLX1. Interacts with CENPF, TRIM9, RIMS1, SNAPIN, OTOF and HGS. Binds STXBP6. Found in a ternary complex with STX1A and VAMP8. Found in a complex containing SYT1, SV2B and syntaxin-1. Associates with the BLOC-1 complex. Interacts with BLOC1S6 . By similarity. Interacts with EQTN . By similarity. Subcellular location: Cytoplasm perinuclear region . By similarity. Cell membrane; Lipid-anchor . By similarity. Cell junction synapse synaptosome . By similarity. Note: Membrane association requires palmitoylation. Expressed throughout cytoplasm, concentrating at the perinuclear region . By similarity. Post-translational modification: Palmitoylated. Cys-85 appears to be the main site, and palmitoylation is required for membrane association . By similarity. Sequence similarities: Belongs to the SNAP-25 family.Contains 2 t-SNARE coiled-coil homology domains.
size1 :
1 mg (E-Coli)
price1 :
1390 USD
size2 :
1 mg (Yeast)
price2 :
1845
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!