catalog number :
MBS961773
products type :
Recombinant Protein
products full name :
Recombinant Pig Niemann-Pick C1 protein (NPC1), partial
products short name :
Niemann-Pick C1 protein (NPC1), partial
products name syn :
Recombinant Niemann-Pick C1 protein (NPC1), partial; Niemann-Pick C1 protein
other names :
Niemann-Pick C1 protein; Niemann-Pick C1 protein; Niemann-Pick C1 protein; Niemann-Pick C disease protein
products gene name syn :
NPC1
other gene names :
NPC1; NPC1
uniprot entry name :
NPC1_PIG
sequence positions :
23-269
sequence :
+QSCVWYGECGIASGDKRYNCRYSGPPKPLPEDGYDLVQELCPGFFFGNVSLCCDVQQLRTLKDNLQLPLQFLSRCPSCFYNLMNLFCELTCSPRQSQFLNVTATEDYVDPVTNQTKTNVK
ELEYYVGETFANAMYNACRDVEAPSSNEKALGLLCGREAQACNATNWIEYMFNKDNGQAPFTITPIFSDLPTHGMEPMNNATKGCDESVDEVTGPCSCQDCSIVCGPKPQPPPPPVPWRILGLDAMY
MAHHHHHHMSDSEVNQEAKPEVKPEVKPETHINLKVSDG
SSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGI
RIQADQTPEDLDMEDNDIIEAHREQIGGGSEFRT
form :
This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Tag Information: A complete extracellular domain at N-terminus; N-terminal His-sumo-tag. Species: Sus scrofa (Pig)
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
ncbi acc num :
NP_999487.1
ncbi gb acc num :
NM_214322.1
ncbi mol weight :
141,963 Da
ncbi pathways :
Lysosome Pathway 98759!!Lysosome Pathway 96865
uniprot summary :
Function: Intracellular cholesterol transporter which acts in concert with NPC2 and plays an important role in the egress of cholesterol from the endosomal/lysosomal compartment. Both NPC1 and NPC2 function as the cellular 'tag team duo' (TTD) to catalyze the mobilization of cholesterol within the multivesicular environment of the late endosome (LE) to effect egress through the limiting bilayer of the LE. NPC2 binds unesterified cholesterol that has been released from LDLs in the lumen of the late endosomes/lysosomes and transfers it to the cholesterol-binding pocket of the N-terminal domain of NPC1. Cholesterol binds to NPC1 with the hydroxyl group buried in the binding pocket and is exported from the limiting membrane of late endosomes/ lysosomes to the ER and plasma membrane by an unknown mechanism. Binds oxysterol with higher affinity than cholesterol. May play a role in vesicular trafficking in glia, a process that may be crucial for maintaining the structural and functional integrity of nerve terminals . By similarity. Subunit structure: Interacts with TMEM97 . By similarity. Interacts (via the second lumenal domain) with NPC2 in a cholestrol-dependent manner . By similarity. Subcellular location: Late endosome membrane; Multi-pass membrane protein . By similarity. Lysosome membrane; Multi-pass membrane protein . By similarity. Domain: A cysteine-rich N-terminal domain and a C-terminal domain containing a di-leucine motif necessary for lysosomal targeting are critical for mobilization of cholesterol from lysosomes . By similarity. Sequence similarities: Belongs to the patched family.Contains 1 SSD (sterol-sensing) domain.
size :
1 mg (E Coli Derived)