product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Integrin alpha-2
catalog :
MBS961599
quantity :
0.01 mg (E-Coli)
price :
110 USD
more info or order :
product information
catalog number :
MBS961599
products type :
Recombinant Protein
products full name :
Recombinant Human Integrin alpha-2
products short name :
Integrin alpha-2
products name syn :
CD49 antigen-like family member B Collagen receptor; Platelet membrane glycoprotein Ia; GPIa; VLA-2 subunit alpha; CD_antigen: CD49b
other names :
integrin alpha-2; Integrin alpha-2; integrin alpha-2; integrin subunit alpha 2; CD49 antigen-like family member B; Collagen receptor; Platelet membrane glycoprotein Ia; GPIa; VLA-2 subunit alpha; CD_antigen: CD49b
products gene name :
ITGA2
other gene names :
ITGA2; ITGA2; BR; GPIa; CD49B; HPA-5; VLA-2; VLAA2; CD49B; GPIa
uniprot entry name :
ITA2_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
188-365
sequence length :
1181
sequence :
WDAVKNFLEKFVQGLDIGPTKTQVGLIQYANNPRVVFNL
NTYKTKEEMIVATSQTSQYGGDLTNTFGAIQYARKYAYS
AASGGRRSATKVMVVVTDGESHDGSMLKAVIDQCNHDNI
LRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFN
VSDEAALLEKAGTLGEQIFSIE
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Homo sapiens (Human)
products categories :
Signal Transduction
products description :
Integrin alpha-2/beta-1 is a receptor for laminin, collagen, collagen C-propeptides, fibronectin and E-cadherin. It recognizes the proline-hydroxylated sequence G-F-P-G-E-R in collagen. It is responsible for adhesion of platelets and other cells to collagens, modulation of collagen and collagenase gene expression, force generation and organization of newly synthesized extracellular matrix.
products references :
The primary structure of the VLA-2/collagen receptor alpha 2 subunit (platelet GPIa): homology to other integrins and the presence of a possible collagen-binding domain." Takada Y., Hemler M.E. J. Cell Biol. 109:397-407(1989)
ncbi gi num :
116295258
ncbi acc num :
NP_002194.2
ncbi gb acc num :
NM_002203.3
uniprot acc num :
P17301
ncbi mol weight :
35.63kD
ncbi pathways :
Arf6 Trafficking Events Pathway (137954); Arrhythmogenic Right Ventricular Cardiomyopathy Pathway (672454); Arrhythmogenic Right Ventricular Cardiomyopathy (ARVC) Pathway (117293); Arrhythmogenic Right Ventricular Cardiomyopathy (ARVC) Pathway (116129); Axon Guidance Pathway (1270303); CHL1 Interactions Pathway (1270327); CXCR4-mediated Signaling Events Pathway (137910); Developmental Biology Pathway (1270302); Dilated Cardiomyopathy Pathway (121494); Dilated Cardiomyopathy Pathway (121285)
ncbi summary :
This gene encodes the alpha subunit of a transmembrane receptor for collagens and related proteins. The encoded protein forms a heterodimer with a beta subunit and mediates the adhesion of platelets and other cell types to the extracellular matrix. Loss of the encoded protein is associated with bleeding disorder platelet-type 9. Antibodies against this protein are found in several immune disorders, including neonatal alloimmune thrombocytopenia. This gene is located adjacent to a related alpha subunit gene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]
uniprot summary :
ITGA2: Integrin alpha-2/beta-1 is a receptor for laminin, collagen, collagen C-propeptides, fibronectin and E-cadherin. It recognizes the proline-hydroxylated sequence G-F-P-G-E-R in collagen. It is responsible for adhesion of platelets and other cells to collagens, modulation of collagen and collagenase gene expression, force generation and organization of newly synthesized extracellular matrix. Belongs to the integrin alpha chain family. Protein type: Cell adhesion; Motility/polarity/chemotaxis; Membrane protein, integral; Receptor, misc. Chromosomal Location of Human Ortholog: 5q11.2. Cellular Component: cell surface; external side of plasma membrane; focal adhesion; integrin complex; nerve terminal; nucleus; perinuclear region of cytoplasm; plasma membrane. Molecular Function: collagen binding; integrin binding; laminin binding; metal ion binding; protein binding; protein complex binding; protein heterodimerization activity; viral receptor activity. Biological Process: axon guidance; blood coagulation; cell adhesion; cell adhesion mediated by integrin; cell proliferation; cell-matrix adhesion; cell-substrate adhesion; detection of mechanical stimulus involved in sensory perception of pain; entry of virus into host cell; establishment of protein localization; extracellular matrix organization and biogenesis; female pregnancy; focal adhesion formation; hypotonic response; integrin-mediated signaling pathway; mammary gland development; mesodermal cell differentiation; organ morphogenesis; positive regulation of cell adhesion; positive regulation of cell projection organization and biogenesis; positive regulation of collagen binding; positive regulation of collagen biosynthetic process; positive regulation of DNA binding; positive regulation of inflammatory response; positive regulation of leukocyte migration; positive regulation of phagocytosis, engulfment; positive regulation of positive chemotaxis; positive regulation of smooth muscle cell migration; positive regulation of smooth muscle cell proliferation; positive regulation of smooth muscle contraction; positive regulation of translation; positive regulation of transmission of nerve impulse; response to amine stimulus; response to drug; response to hypoxia; response to L-ascorbic acid; response to muscle activity; skin morphogenesis; substrate-bound cell migration. Disease: Bleeding Disorder, Platelet-type, 9
size1 :
0.01 mg (E-Coli)
price1 :
110 USD
size2 :
0.05 mg (Yeast)
price2 :
145
size3 :
0.05 mg (E-Coli)
price3 :
190
size4 :
0.2 mg (Yeast)
price4 :
315
size5 :
0.2 mg (E-Coli)
price5 :
460
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!