protein

Recombinant Human Integrin alpha-2

MBS961599

0.01 mg (E-Coli)

110 USD

Recombinant Protein

Recombinant Human Integrin alpha-2

Integrin alpha-2

CD49 antigen-like family member B Collagen receptor; Platelet membrane glycoprotein Ia; GPIa; VLA-2 subunit alpha; CD_antigen: CD49b

integrin alpha-2; Integrin alpha-2; integrin alpha-2; integrin subunit alpha 2; CD49 antigen-like family member B; Collagen receptor; Platelet membrane glycoprotein Ia; GPIa; VLA-2 subunit alpha; CD_antigen: CD49b

ITGA2

ITGA2; ITGA2; BR; GPIa; CD49B; HPA-5; VLA-2; VLAA2; CD49B; GPIa

ITA2_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

188-365

1181

WDAVKNFLEKFVQGLDIGPTKTQVGLIQYANNPRVVFNL
NTYKTKEEMIVATSQTSQYGGDLTNTFGAIQYARKYAYS
AASGGRRSATKVMVVVTDGESHDGSMLKAVIDQCNHDNI
LRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFN
VSDEAALLEKAGTLGEQIFSIE

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Species: Homo sapiens (Human)

Signal Transduction

Integrin alpha-2/beta-1 is a receptor for laminin, collagen, collagen C-propeptides, fibronectin and E-cadherin. It recognizes the proline-hydroxylated sequence G-F-P-G-E-R in collagen. It is responsible for adhesion of platelets and other cells to collagens, modulation of collagen and collagenase gene expression, force generation and organization of newly synthesized extracellular matrix.

The primary structure of the VLA-2/collagen receptor alpha 2 subunit (platelet GPIa): homology to other integrins and the presence of a possible collagen-binding domain." Takada Y., Hemler M.E. J. Cell Biol. 109:397-407(1989)

116295258

NP_002194.2

NM_002203.3

P17301

35.63kD

Arf6 Trafficking Events Pathway (137954); Arrhythmogenic Right Ventricular Cardiomyopathy Pathway (672454); Arrhythmogenic Right Ventricular Cardiomyopathy (ARVC) Pathway (117293); Arrhythmogenic Right Ventricular Cardiomyopathy (ARVC) Pathway (116129); Axon Guidance Pathway (1270303); CHL1 Interactions Pathway (1270327); CXCR4-mediated Signaling Events Pathway (137910); Developmental Biology Pathway (1270302); Dilated Cardiomyopathy Pathway (121494); Dilated Cardiomyopathy Pathway (121285)

This gene encodes the alpha subunit of a transmembrane receptor for collagens and related proteins. The encoded protein forms a heterodimer with a beta subunit and mediates the adhesion of platelets and other cell types to the extracellular matrix. Loss of the encoded protein is associated with bleeding disorder platelet-type 9. Antibodies against this protein are found in several immune disorders, including neonatal alloimmune thrombocytopenia. This gene is located adjacent to a related alpha subunit gene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]

ITGA2: Integrin alpha-2/beta-1 is a receptor for laminin, collagen, collagen C-propeptides, fibronectin and E-cadherin. It recognizes the proline-hydroxylated sequence G-F-P-G-E-R in collagen. It is responsible for adhesion of platelets and other cells to collagens, modulation of collagen and collagenase gene expression, force generation and organization of newly synthesized extracellular matrix. Belongs to the integrin alpha chain family. Protein type: Cell adhesion; Motility/polarity/chemotaxis; Membrane protein, integral; Receptor, misc. Chromosomal Location of Human Ortholog: 5q11.2. Cellular Component: cell surface; external side of plasma membrane; focal adhesion; integrin complex; nerve terminal; nucleus; perinuclear region of cytoplasm; plasma membrane. Molecular Function: collagen binding; integrin binding; laminin binding; metal ion binding; protein binding; protein complex binding; protein heterodimerization activity; viral receptor activity. Biological Process: axon guidance; blood coagulation; cell adhesion; cell adhesion mediated by integrin; cell proliferation; cell-matrix adhesion; cell-substrate adhesion; detection of mechanical stimulus involved in sensory perception of pain; entry of virus into host cell; establishment of protein localization; extracellular matrix organization and biogenesis; female pregnancy; focal adhesion formation; hypotonic response; integrin-mediated signaling pathway; mammary gland development; mesodermal cell differentiation; organ morphogenesis; positive regulation of cell adhesion; positive regulation of cell projection organization and biogenesis; positive regulation of collagen binding; positive regulation of collagen biosynthetic process; positive regulation of DNA binding; positive regulation of inflammatory response; positive regulation of leukocyte migration; positive regulation of phagocytosis, engulfment; positive regulation of positive chemotaxis; positive regulation of smooth muscle cell migration; positive regulation of smooth muscle cell proliferation; positive regulation of smooth muscle contraction; positive regulation of translation; positive regulation of transmission of nerve impulse; response to amine stimulus; response to drug; response to hypoxia; response to L-ascorbic acid; response to muscle activity; skin morphogenesis; substrate-bound cell migration. Disease: Bleeding Disorder, Platelet-type, 9

0.01 mg (E-Coli)

110 USD

0.05 mg (Yeast)

145

0.05 mg (E-Coli)

190

0.2 mg (Yeast)

315

0.2 mg (E-Coli)

460