protein

Recombinant Mouse Histone H2B type 1-M

MBS961570

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Mouse Histone H2B type 1-M

Histone H2B type 1-M

H2B 291B

histone H2B type 1-M; Histone H2B type 1-M; histone H2B type 1-M; histone cluster 1, H2bm; H2B 291B

Hist1h2bm

Hist1h2bm; Hist1h2bm; H2b-291b

H2B1M_MOUSE

E Coli or Yeast or Baculovirus or Mammalian Cell

2-126

126

PEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSV
YVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEAS
RLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKA
VTKYTSSK

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Mouse histone H2A and H2B genes four functional genes and a pseudogene undergoing gene conversion with a closely linked functional gene.Liu T.-J., Liu L., Marzluff W.F.Nucleic Acids Res. 15:3023-3039(1987) The human and mouse replication-dependent histone genes.Marzluff W.F., Gongidi P., Woods K.R., Jin J., Maltais L.J.Genomics 80:487-498(2002) Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) Phosphorylation of histone H2B at DNA double-strand breaks.Fernandez-Capetillo O., Allis C.D., Nussenzweig A.J. Exp. Med. 199:1671-1677(2004) Histone modifications associated with somatic hypermutation.Odegard V.H., Kim S.T., Anderson S.M., Shlomchik M.J., Schatz D.G.Immunity 23:101-110(2005) Signaling kinase AMPK activates stress-promoted transcription via histone H2B phosphorylation.Bungard D., Fuerth B.J., Zeng P.Y., Faubert B., Maas N.L., Viollet B., Carling D., Thompson C.B., Jones R.G., Berger S.L.Science 329:1201-1205(2010) Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.Tan M., Luo H., Lee S., Jin F., Yang J.S., Montellier E., Buchou T., Cheng Z., Rousseaux S., Rajagopal N., Lu Z., Ye Z., Zhu Q., Wysocka J., Ye Y., Khochbin S., Ren B., Zhao Y.Cell 146:1016-1028(2011) SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013)

30061385

NP_835507.1

NM_178200.2

P10854

17.9kD

Alcoholism Pathway (585577); Alcoholism Pathway (587116); Chromatin Modifying Enzymes Pathway (1324501); Chromatin Organization Pathway (1324500); Diurnally Regulated Genes With Circadian Orthologs Pathway (198406); HATs Acetylate Histones Pathway (1324502); Meiotic Recombination Pathway (966900); Meiotic Synapsis Pathway (966901); Mus Musculus Biological Processes Pathway (966896); NoRC Negatively Regulates RRNA Expression Pathway (966902)

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2B family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. [provided by RefSeq, Aug 2015]

H2B1D: a core component of the nucleoosome. The nucleosome, a basic organizational unit of chromosomal DNA, is octrameric, consisting of two molecules each of histones H2B, H2A, H3, H4. The octamer wraps approximately 147 bp of DNA. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Interacts with acetylated H4 during chromatin remodeling. Binds to HIRA, a replication-dependent histone family member. Protein type: DNA-binding. Cellular Component: chromosome; cytoplasm; nucleoplasm; nucleosome; nucleus. Molecular Function: DNA binding; protein heterodimerization activity. Biological Process: nucleosome assembly

0.05 mg (E-Coli)

190 USD

0.2 mg (E-Coli)

460

0.5 mg (E-Coli)

750

0.05 mg (Baculovirus)

860

0.05 mg (Mammalian-Cell)

1085