ANTEIIVKLSDGRELCLDPKEPWVQRVVEKFVKRAENQN
P

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Bovine Collagen alpha-1 (XII) chain (COL12A1) | MBS961514
- Recombinant Human Integrin alpha-2 | MBS961599
- Recombinant Mouse Indolethylamine N-methyltransferase (Inmt) | MBS961746
- Recombinant Macaca mulatta (Rhesus macaque) C-C chemokine receptor type 1 (CCR1)
- Recombinant Macaca mulatta (Rhesus macaque) Synaptosomal-associated protein 25 ( ...