product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Macaca mulatta (Rhesus macaque) Interleukin-8 (IL8)
catalog :
MBS961445
quantity :
1 mg (E-Coli)
price :
1095 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS961445
products type :
Recombinant Protein
products full name :
Recombinant Macaca mulatta (Rhesus macaque) Interleukin-8 (IL8)
products short name :
(Rhesus macaque) Interleukin-8 (IL8)
products name syn :
Recombinant (Rhesus macaque) Interleukin-8 (IL8); Interleukin-8; IL-8; C-X-C motif chemokine 8
other names :
interleukin-8; Interleukin-8; interleukin-8; IL-8; C-X-C motif chemokine 8; C-X-C motif chemokine 8
products gene name syn :
IL8; CXCL8
other gene names :
IL8; IL8; CXCL8; IL-8
uniprot entry name :
IL8_MACMU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
23-101
sequence length :
101
sequence :
AVLPRSAKELRCECIKTYSKPFHPKFIKELRVIESGPHC
ANTEIIVKLSDGRELCLDPKEPWVQRVVEKFVKRAENQN
P
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Species: Macaca mulatta (Rhesus macaque)
ncbi gi num :
74136483
ncbi acc num :
NP_001028137.1
ncbi gb acc num :
NM_001032965.1
uniprot acc num :
P67813
ncbi mol weight :
11,320 Da
ncbi pathways :
Amoebiasis Pathway (167336); Amoebiasis Pathway (167191); Bladder Cancer Pathway (86781); Bladder Cancer Pathway (527); Chagas Disease (American Trypanosomiasis) Pathway (147811); Chagas Disease (American Trypanosomiasis) Pathway (147795); Chemokine Signaling Pathway (99278); Chemokine Signaling Pathway (96864); Cytokine-cytokine Receptor Interaction Pathway (86721); Cytokine-cytokine Receptor Interaction Pathway (460)
uniprot summary :
Function: IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus . By similarity. Subunit structure: Homodimer . By similarity. Subcellular location: Secreted. Sequence similarities: Belongs to the intercrine alpha (chemokine CxC) family.
size1 :
1 mg (E-Coli)
price1 :
1095 USD
size2 :
1 mg (Yeast)
price2 :
1555
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!