protein

Recombinant Human Interferon alpha-14

MBS961403

0.05 mg (E-Coli)

180 USD

Recombinant Protein

Recombinant Human Interferon alpha-14

Interferon alpha-14

Interferon alpha-H; LeIF HInterferon lambda-2-H

interferon alpha-14; Interferon alpha-14; interferon alpha-14; interferon, alpha 14; Interferon alpha-H; LeIF H; Interferon lambda-2-H

IFNA14

IFNA14; IFNA14; LEIF2H; IFN-alphaH; IFN-alpha-14; LeIF H

IFN14_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

24-189; Mature full length protein

189

CNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFP
QEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWD
ETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSI
LAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFST
NLQKRLRRKD

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Immunology

Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

The structure of eight distinct cloned human leukocyte interferon cDNAs.Goeddel D.V., Leung D.W., Dull T.J., Gross M., Lawn R.M., McCandliss R., Seeburg P.H., Ullrich A., Yelverton E., Gray P.W.Nature 290:20-26(1981) DNA sequence of two closely linked human leukocyte interferon genes.Lawn R.M., Adelman J., Dull T.J., Gross M., Goeddel D.V., Ullrich A.Science 212:1159-1162(1981) Structural relationship of human interferon alpha genes and pseudogenes.Henco K., Brosius J., Fujisawa A., Fujisawa J., Haynes J.R., Hochstadt J., Kovacic T., Pasek M., Schamboeck A., Schmid J., Todokoro K., Waelchli M., Nagata S., Weissmann C.J. Mol. Biol. 185:227-260(1985) DNA sequence and analysis of human chromosome 9.Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.Nature 429:369-374(2004)

170763491

NP_002163.2

NM_002172.2

P01570

47.1kD

Autoimmune Thyroid Disease Pathway (83121); Autoimmune Thyroid Disease Pathway (533); Cytokine Signaling In Immune System Pathway (1269310); Cytokine-cytokine Receptor Interaction Pathway (83051); Cytokine-cytokine Receptor Interaction Pathway (460); Cytosolic DNA-sensing Pathway (125137); Cytosolic DNA-sensing Pathway (124833); Factors Involved In Megakaryocyte Development And Platelet Production Pathway (1269377); Hemostasis Pathway (1269340); Hepatitis B Pathway (694606)

IFNA14: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. Belongs to the alpha/beta interferon family. Protein type: Membrane protein, integral; Secreted, signal peptide; Secreted. Chromosomal Location of Human Ortholog: 9p22. Cellular Component: extracellular region; extracellular space. Molecular Function: cytokine activity; hematopoietin/interferon-class (D200-domain) cytokine receptor binding; interferon-alpha/beta receptor binding. Biological Process: adaptive immune response; B cell differentiation; B cell proliferation; blood coagulation; cytokine and chemokine mediated signaling pathway; defense response to virus; humoral immune response; innate immune response; natural killer cell activation during immune response; positive regulation of peptidyl-serine phosphorylation of STAT protein; response to exogenous dsRNA; T cell activation during immune response

0.05 mg (E-Coli)

180 USD

0.05 mg (Yeast)

260

0.2 mg (E-Coli)

490

0.2 mg (Yeast)

600

0.5 mg (E-Coli)

715