Recombinant Mouse CD63 antigen | MyBioSource MBS961118 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Mouse CD63 antigen

catalog :

MBS961118

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS961118

products type :

Recombinant Protein

products full name :

Recombinant Mouse CD63 antigen

products short name :

CD63 antigen

products name syn :

CD63

other names :

CD63 antigen; CD63 antigen; CD63 antigen; CD63 antigen; CD_antigen: CD63

products gene name :

Cd63

other gene names :

Cd63; Cd63; ME491; C75951; Tspan30

uniprot entry name :

CD63_MOUSE

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

103-203

sequence length :

238

sequence :

AGYVFRDQVKSEFNKSFQQQMQNYLKDNKTATILDKLQK
ENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGND
FKESTIHTQGCVETIAIWLRKNI

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

Functions as cell surface receptor for TIMP1 and plays a role in the activation of cellular signaling cascades. Plays a role in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2 and MAP kinases. Promotes cell survival, reorganization of the actin cytoskeleton, cell adhesion, spreading and migration, via its role in the activation of AKT and FAK/PTK2. Plays a role in VEGFA signaling via its role in regulating the internalization of KDR/VEGFR2. Plays a role in intracellular vesicular transport processes, and is required for normal trafficking of the PMEL luminal domain that is essential for the development and maturation of melanocytes. Plays a role in the adhesion of leukocytes onto endothelial cells via its role in the regulation of SELP trafficking. May play a role in mast cell degranulation in response to Ms4a2/FceRI stimulation, but not in mast cell degranulation in response to other stimuli.

products references :

Molecular cloning of the murine homologue of CD63/ME491 and detection of its strong expression in the kidney and activated macrophages.Miyamoto M., Homma M., Hotta H.Biochim. Biophys. Acta 1217:312-316(1994) Deficiency of the tetraspanin CD63 associated with kidney pathology but normal lysosomal function.Schroder J., Lullmann-Rauch R., Himmerkus N., Pleines I., Nieswandt B., Orinska Z., Koch-Nolte F., Schroder B., Bleich M., Saftig P.Mol. Cell. Biol. 29:1083-1094(2009) Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.Nat. Biotechnol. 27:378-386(2009) CD63 is an essential cofactor to leukocyte recruitment by endothelial P-selectin.Doyle E.L., Ridger V., Ferraro F., Turmaine M., Saftig P., Cutler D.F.Blood 118:4265-4273(2011) The tetraspanin CD63 regulates ESCRT-independent and -dependent endosomal sorting during melanogenesis.van Niel G., Charrin S., Simoes S., Romao M., Rochin L., Saftig P., Marks M.S., Rubinstein E., Raposo G.Dev. Cell 21:708-721(2011) Tetraspanin CD63 promotes vascular endothelial growth factor receptor 2-beta1 integrin complex formation, thereby regulating activation and downstream signaling in endothelial cells in vitro and in vivo.Tugues S., Honjo S., Konig C., Padhan N., Kroon J., Gualandi L., Li X., Barkefors I., Thijssen V.L., Griffioen A.W., Claesson-Welsh L.J. Biol. Chem. 288:19060-19071(2013) The tetraspanin CD63 is required for efficient IgE-mediated mast cell degranulation and anaphylaxis.Kraft S., Jouvin M.H., Kulkarni N., Kissing S., Morgan E.S., Dvorak A.M., Schroder B., Saftig P., Kinet J.P.J. Immunol. 191:2871-2878(2013)

ncbi gi num :

110431344

ncbi acc num :

NP_001036045.1

ncbi gb acc num :

NM_001042580.1

uniprot acc num :

P41731

ncbi mol weight :

15.6kD

ncbi pathways :

Hemostasis Pathway (1323559); Lysosome Pathway (99272); Lysosome Pathway (96865); Platelet Activation, Signaling And Aggregation Pathway (1323569); Platelet Degranulation Pathway (1323586); Proteoglycans In Cancer Pathway (782024); Proteoglycans In Cancer Pathway (782054); Response To Elevated Platelet Cytosolic Ca2+ Pathway (1323584)

uniprot summary :

CD63: This antigen is associated with early stages of melanoma tumor progression. May play a role in growth regulation. Belongs to the tetraspanin (TM4SF) family. Protein type: Membrane protein, multi-pass; Membrane protein, integral. Cellular Component: cell surface; cytoplasm; endosome; endosome membrane; extracellular region; extracellular space; integral to membrane; integral to plasma membrane; intrinsic to plasma membrane; late endosome; late endosome membrane; lysosomal membrane; lysosome; membrane; plasma membrane; protein complex. Molecular Function: protein binding; protein complex binding. Biological Process: cell adhesion; cell migration; cell surface receptor linked signal transduction; cell-matrix adhesion; epithelial cell differentiation; pigment cell differentiation; pigment granule maturation; pigmentation; positive regulation of cell adhesion; positive regulation of endocytosis; positive regulation of receptor internalization; protein transport; transport

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

1 mg (E-Coli)

price4 :

1180

size5 :

1 mg (Yeast)

price5 :

2135

more info or order :

MyBioSource product webpage