Recombinant Human Tumor necrosis factor-inducible gene 6 protein | MyBioSource MBS961093 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Tumor necrosis factor-inducible gene 6 protein

catalog :

MBS961093

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS961093

products type :

Recombinant Protein

products full name :

Recombinant Human Tumor necrosis factor-inducible gene 6 protein

products short name :

Tumor necrosis factor-inducible gene 6

products name syn :

Hyaluronate-binding protein; TNF-stimulated gene 6 protein; TSG-6; Tumor necrosis factor alpha-induced protein 6; TNF alpha-induced protein 6

other names :

tumor necrosis factor-inducible gene 6 protein; Tumor necrosis factor-inducible gene 6 protein; tumor necrosis factor-inducible gene 6 protein; TNF alpha induced protein 6; Hyaluronate-binding protein; TNF-stimulated gene 6 protein; TSG-6; Tumor necrosis factor alpha-induced protein 6; TNF alpha-induced protein 6

products gene name :

TNFAIP6

other gene names :

TNFAIP6; TNFAIP6; TSG6; TSG-6; TSG6; TSG-6; TNF alpha-induced protein 6

uniprot entry name :

TSG6_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

18-277, Mature full length protein.

sequence length :

277

sequence :

WGFKDGIFHNSIWLERAAGVYHREARSGKYKLTYAEAKA
VCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGRVGYP
IVKPGPNCGFGKTGIIDYGIRLNRSERWDAYCYNPHAKE
CGGVFTDPKQIFKSPGFPNEYEDNQICYWHIRLKYGQRI
HLSFLDFDLEDDPGCLADYVEIYDSYDDVHGFVGRYCGD
ELPDDIISTGNVMTLKFLSDASVTAGGFQIKYVAMDPVS
KSSQGKNTSTTSTGNKNFLAGRFSHL

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Cell Adhesion

products description :

Possibly involved in cell-cell and cell-matrix interactions during inflammation and tumorigenesis.

products references :

A novel secretory tumor necrosis factor-inducible protein (TSG-6) is a member of the family of hyaluronate binding proteins, closely related to the adhesion receptor CD44.Lee T.H., Wisniewski H.-G., Vilcek J.J. Cell Biol. 116:545-557(1992) A novel allelic variant of the human TSG-6 gene encoding an amino acid difference in the CUB module. Chromosomal localization, frequency analysis, modeling, and expression.Nentwich H.A., Mustafa Z., Rugg M.S., Marsden B.D., Cordell M.R., Mahoney D.J., Jenkins S.C., Dowling B., Fries E., Milner C.M., Loughlin J., Day A.J.J. Biol. Chem. 277:15354-15362(2002) Generation and annotation of the DNA sequences of human chromosomes 2 and 4.Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.Nature 434:724-731(2005)

ncbi gi num :

26051243

ncbi acc num :

NP_009046.2

ncbi gb acc num :

NM_007115.3

uniprot acc num :

P98066

ncbi mol weight :

33.2kD

ncbi summary :

The protein encoded by this gene is a secretory protein that contains a hyaluronan-binding domain, and thus is a member of the hyaluronan-binding protein family. The hyaluronan-binding domain is known to be involved in extracellular matrix stability and cell migration. This protein has been shown to form a stable complex with inter-alpha-inhibitor (I alpha I), and thus enhance the serine protease inhibitory activity of I alpha I, which is important in the protease network associated with inflammation. This gene can be induced by proinflammatory cytokines such as tumor necrosis factor alpha and interleukin-1. Enhanced levels of this protein are found in the synovial fluid of patients with osteoarthritis and rheumatoid arthritis.[provided by RefSeq, Dec 2010]

uniprot summary :

TNFAIP6: Possibly involved in cell-cell and cell-matrix interactions during inflammation and tumorigenesis. Chromosomal Location of Human Ortholog: 2q23.3. Molecular Function: hyaluronic acid binding. Biological Process: cell adhesion; cell-cell signaling; inflammatory response; negative regulation of inflammatory response; signal transduction

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

0.05 mg (Baculovirus)

price4 :

990

size5 :

0.05 mg (Mammalian-Cell)

price5 :

1170

more info or order :

MyBioSource product webpage