protein

Recombinant Mouse C-C chemokine receptor type 5

MBS960718

INQUIRE

INQUIRE

Recombinant Protein

Recombinant Mouse C-C chemokine receptor type 5

C-C chemokine receptor type 5

C-C chemokine receptor type 5; C-C chemokine receptor type 5; C-C chemokine receptor type 5; chemokine (C-C motif) receptor 5; MIP-1 alpha receptor; CD_antigen: CD195

Ccr5

Ccr5; Ccr5; AM4-7; CD195; Cmkbr5; Cmkbr5; C-C CKR-5; CC-CKR-5; CCR-5

CCR5_MOUSE

E Coli or Yeast or Baculovirus or Mammalian Cell

263-354

354

QEFFGLNNCSSSNRLDQAMQATETLGMTHCCLNPVIYAF
VGEKFRSYLSVFFRKHMVKRFCKRCSIFQQDNPDRASSV
YTRSTGEHEVSTGL

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

31542356

NP_034047.2

NM_009917.5

P51682

12.56kD

Beta Defensins Pathway (1323729); Chemokine Signaling Pathway (99271); Chemokine Signaling Pathway (672435); Chemokine Signaling Pathway (96864); Cytokine-cytokine Receptor Interaction Pathway (83248); Cytokine-cytokine Receptor Interaction Pathway (460); Defensins Pathway (1323728); Endocytosis Pathway (102286); Endocytosis Pathway (102181); G Alpha (i) Signalling Events Pathway (1324737)

CCR5: a 7-transmembrane G-linked receptor for a number of inflammatory C-C type chemokines including MIP-1-alpha, MIP-1-beta and RANTES. Transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation. Acts as a coreceptor (along with CD4) for HIV-1 R5 isolates. Interacts with PRAF2. Interacts with HIV-1 surface protein gp120. Efficient ligand binding to CCL3/MIP-1alpha and CCR4/MIP-1beta requires sulfation, O-glycosylation and sialic acid modifications. Glycosylation on S6 is required for efficient binding of CCL4. Interacts with ADRBK1. Interacts with ARRB1 and ARRB2. Variations in CCR5 are associated with resistance or susceptibility to immunodeficiency virus type 1 (resistance or susceptibility to HIV-1). Variations in CCR5 gene also influence the rate of progression to AIDS after infection. R60S variant, a naturally occurring mutation in a conserved residue in the first intracellular domain of CCR5, results in reduced amounts of the protein in the membrane and consequently may be associated with reduced susceptibility to infection by microbes that depend on these molecules as their receptors. Variations in CCR5 are associated with susceptibility to West Nile virus (WNV) infection. Protein type: Membrane protein, multi-pass; GPCR, family 1; Receptor, GPCR; Motility/polarity/chemotaxis; Receptor, cytokine; Membrane protein, integral. Cellular Component: cell surface; cytoplasm; cytosol; endosome; external side of plasma membrane; integral to membrane; membrane; plasma membrane. Molecular Function: actin binding; C-C chemokine binding; C-C chemokine receptor activity; chemokine receptor activity; G-protein coupled receptor activity; glycoprotein binding; protein kinase binding; signal transducer activity. Biological Process: calcium ion transport; calcium-mediated signaling; cell-cell signaling; chemotaxis; defense response; elevation of cytosolic calcium ion concentration; G-protein coupled receptor protein signaling pathway; immune response; inflammatory response; negative regulation of axon extension; negative regulation of cell migration; positive regulation of apoptosis by virus; positive regulation of cell-cell adhesion; positive regulation of fever; positive regulation of inflammatory response; positive regulation of interleukin-1 beta secretion; positive regulation of interleukin-6 production; positive regulation of neuron differentiation; positive regulation of tumor necrosis factor production; release of sequestered calcium ion by sarcoplasmic reticulum into cytosol; signal transduction

INQUIRE

INQUIRE