YDAAKRGPGGAWAAKVISDARENFQRFTDRFSFGGSGRG
AEDSRADQAANEWGRSGKDPNHFRPHGLPDKY

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Human Angiopoietin-related protein 4 | MBS961250
- Recombinant Human Bone morphogenetic protein 2 (BMP2) | MBS963472
- Recombinant Human Creatine kinase U-type, mitochondrial | MBS963626
- Recombinant Rat Regenerating islet-derived protein 3-gamma | MBS963651
- Recombinant Human Vitamin D-binding protein | MBS964406