Recombinant Mouse Macrosialin | MyBioSource MBS960585 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Mouse Macrosialin

catalog :

MBS960585

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS960585

products type :

Recombinant Protein

products full name :

Recombinant Mouse Macrosialin

products short name :

Macrosialin

products name syn :

CD68

other names :

macrosialin; Macrosialin; macrosialin; CD68 antigen; CD_antigen: CD68

products gene name :

Cd68

other gene names :

Cd68; Cd68; Lamp4; gp110; Scard1

uniprot entry name :

CD68_MOUSE

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

21-291

sequence length :

326

sequence :

DCPHKKAVTLLPSFTMTPTATESTASPTTSHRPTTTSHG
NVTVHTSSGPTTVTHNPATTTSHGNATISHATVSPTTNG
TATSPRSSTVGPHPGPPPPSPSPRSKGALGNYTWANGSQ
PCVQLQAQIQIRILYPIQGGRKAWGISVLNPNKTKVQGG
CDGTHPHLSLSFPYGQLTFGFKQDLHQSPSTVYLDYMAV
EYNVSFPQAAQWTFMAQNSSLRELQAPLGQSFCCGNASI
VLSPAVHLDLLSLRLQAAQLP

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

Could play a role in phagocytic activities of tissue macrophages, both in intracellular lysosomal metabolism and extracellular cell-cell and cell-pathogen interactions. Binds to tissue- and organ-specific lectins or selectins, allowing homing of macrophage subsets to particular sites. Rapid recirculation of CD68 from endosomes and lysosomes to the plasma membrane may allow macrophages to crawl over selectin-bearing substrates or other cells.

products references :

Macrosialin, a mouse macrophage-restricted glycoprotein, is a member of the lamp/lgp family.Holness C.L., da Silva R.P., Fawcett J., Gordon S., Simmons D.L.J. Biol. Chem. 268:9661-9666(1993) Structure, organization, and chromosomal mapping of the gene encoding macrosialin, a macrophage-restricted protein.Jiang Z., Shih D.M., Xia Y.R., Lusis A.J., de Beer F.C., de Villiers W.J.S., van der Westhuyzen D.R., de Beer M.C.Genomics 50:199-205(1998) Functional comparison of the murine macrosialin and human CD68 promoters in macrophage and nonmacrophage cell lines.Greaves D.R., Quinn C.M., Seldin M.F., Gordon S.Genomics 54:165-168(1998) The macrosialin promoter directs high levels of transcriptional activity in macrophages dependent on combinatorial interactions between PU.1 and c-Jun.Li A.C., Guidez F.R.B., Collier J.G., Glass C.K.J. Biol. Chem. 273:5389-5399(1998) Five different genes, Eif4a1, Cd68, Supl15h, Sox15 and Fxr2h, are clustered in a 40 kb region of mouse chromosome 11.Miyashita A., Shimizu N., Endo N., Hanyuu T., Ishii N., Ito K., Itoh Y., Shirai M., Nakajima T., Odani S., Kuwano R.Gene 237:53-60(1999) Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) Influence of caloric restriction on motor behavior, longevity, and brain lipid composition in Sandhoff disease mice.Denny C.A., Kasperzyk J.L., Gorham K.N., Bronson R.T., Seyfried T.N.J. Neurosci. Res. 83:1028-1038(2006)

ncbi gi num :

597508192

ncbi acc num :

NP_001277987.1

ncbi gb acc num :

NM_001291058.1

uniprot acc num :

P31996

ncbi mol weight :

44.7kD

ncbi pathways :

Lysosome Pathway (99272); Lysosome Pathway (96865); Macrophage Markers Pathway (672439)

uniprot summary :

CD68: Could play a role in phagocytic activities of tissue macrophages, both in intracellular lysosomal metabolism and extracellular cell-cell and cell-pathogen interactions. Binds to tissue- and organ-specific lectins or selectins, allowing homing of macrophage subsets to particular sites. Rapid recirculation of CD68 from endosomes and lysosomes to the plasma membrane may allow macrophages to crawl over selectin-bearing substrates or other cells. Belongs to the LAMP family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Cell surface; Membrane protein, integral. Cellular Component: endosome; integral to membrane; lysosome; membrane; plasma membrane

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.05 mg (Yeast)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.2 mg (Yeast)

price4 :

460

size5 :

0.5 mg (Yeast)

price5 :

750

more info or order :

MyBioSource product webpage