product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Transmembrane 4 L6 family member 1
catalog :
MBS960573
quantity :
INQUIRE
price :
INQUIRE
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS960573
products type :
Recombinant Protein
products full name :
Recombinant Human Transmembrane 4 L6 family member 1
products short name :
Transmembrane 4 L6 family member 1
products name syn :
Membrane component chromosome 3 surface marker 1; Tumor-associated antigen L6
other names :
transmembrane 4 L6 family member 1; Transmembrane 4 L6 family member 1; transmembrane 4 L6 family member 1; transmembrane 4 L six family member 1; Membrane component chromosome 3 surface marker 1; Tumor-associated antigen L6
products gene name :
TM4SF1
other gene names :
TM4SF1; TM4SF1; L6; H-L6; M3S1; TAAL6; M3S1; TAAL6
uniprot entry name :
T4S1_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
115-161
sequence length :
202
sequence :
LAEGPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPK
HIVEWNVS
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Homo sapiens (Human)
products categories :
Cancer
products references :
Cloning and expression of the tumor-associated antigen L6." Marken J.S., Schieven G.L., Hellstroem I., Hellstroem K.E., Aruffo A. Proc. Natl. Acad. Sci. U.S.A. 89:3503-3507(1992)
ncbi gi num :
21265101
ncbi acc num :
NP_055035.1
ncbi gb acc num :
NM_014220.2
uniprot acc num :
P30408
ncbi mol weight :
7.32KD
ncbi summary :
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface antigen and is highly expressed in different carcinomas. [provided by RefSeq, Jul 2008]
uniprot summary :
TM4SF1: a multi-pass membrane protein. Member of the transmembrane 4 superfamily, also known as the tetraspanin family. These proteins apparently mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This protein is highly expressed in lung, breast, colon and ovarian carcinomas. It is also present on some normal cells, endothelial cells in particular. Present in high molecular weight complexes in tumor cells. Protein type: Membrane protein, multi-pass; Membrane protein, integral. Chromosomal Location of Human Ortholog: 3q21-q25. Cellular Component: integral to plasma membrane
size1 :
INQUIRE
price1 :
INQUIRE
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!