protein

Recombinant Human Catechol O-methyltransferase (COMT)

MBS960242

INQUIRE

INQUIRE

Recombinant Protein

Recombinant Human Catechol O-methyltransferase (COMT)

Catechol O-methyltransferase (COMT)

Catechol O-methyltransferase; EC=2.1.1.6

catechol O-methyltransferase isoform MB-COMT; Catechol O-methyltransferase; catechol O-methyltransferase; epididymis secretory sperm binding protein Li 98n; catechol-O-methyltransferase

COMT

COMT; COMT; HEL-S-98n

COMT_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

1-221; Provide the full length of Isoform Soluble (identifier: P21964-2)

221

VLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDV DTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYRE VVDGLEKAIYKGPGSEAGP
MGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWA
MNVGDKKGKIVDAVIQEHQPS

>90%

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Species: Homo sapiens (Human)

4502969

NP_000745.1

NM_000754.3

P21964

24,449 Da

Biogenic Amine Synthesis Pathway (198793); Biological Oxidations Pathway (105698); Dopamine Clearance From The Synaptic Cleft Pathway (106527); Dopaminergic Synapse Pathway (469199); Dopaminergic Synapse Pathway (469185); Enzymatic Degradation Of Dopamine By Monoamine Oxidase Pathway (106529); Enzymatic Degradation Of Dopamine By COMT Pathway (106528); Estrogen Metabolism Pathway (198898); L-dopa Degradation Pathway (545339); Metabolism Pathway (477135)

Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathways of the catecholamine transmitters. In addition to its role in the metabolism of endogenous substances, COMT is important in the metabolism of catechol drugs used in the treatment of hypertension, asthma, and Parkinson disease. COMT is found in two forms in tissues, a soluble form (S-COMT) and a membrane-bound form (MB-COMT). The differences between S-COMT and MB-COMT reside within the N-termini. Several transcript variants are formed through the use of alternative translation initiation sites and promoters. [provided by RefSeq, Sep 2008]

COMT: Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol. Belongs to the mammalian catechol-O-methyltransferase family. 2 isoforms of the human protein are produced by alternative initiation. Protein type: Membrane protein, integral; Methyltransferase; Amino Acid Metabolism - tyrosine; EC 2.1.1.6. Chromosomal Location of Human Ortholog: 22q11.21. Cellular Component: postsynaptic membrane; mitochondrion; membrane; axon; integral to membrane; plasma membrane; dendritic spine; cytosol. Molecular Function: protein binding; magnesium ion binding; O-methyltransferase activity; catechol O-methyltransferase activity. Biological Process: response to drug; methylation; estrogen metabolic process; cellular response to phosphate starvation; neurotransmitter catabolic process; dopamine catabolic process; negative regulation of smooth muscle cell proliferation; short-term memory; response to pain; response to lipopolysaccharide; learning; female pregnancy; reproductive process in a multicellular organism; positive regulation of homocysteine metabolic process; response to organic cyclic substance; negative regulation of dopamine metabolic process; synaptic transmission; xenobiotic metabolic process; regulation of sensory perception of pain; developmental process; neurotransmitter biosynthetic process. Disease: Schizophrenia; Panic Disorder 1

INQUIRE

INQUIRE