Recombinant Human Thrombopoietin receptor | MyBioSource MBS960212 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Thrombopoietin receptor

catalog :

MBS960212

quantity :

0.05 mg (E-Coli)

price :

185 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS960212

products type :

Recombinant Protein

products full name :

Recombinant Human Thrombopoietin receptor

products short name :

Thrombopoietin

products name syn :

Myeloproliferative leukemia protein; Proto-oncogene c-Mpl; CD110

other names :

thrombopoietin receptor; Thrombopoietin receptor; thrombopoietin receptor; MPL proto-oncogene, thrombopoietin receptor; Myeloproliferative leukemia protein; Proto-oncogene c-Mpl; CD_antigen: CD110

products gene name :

MPL

other gene names :

MPL; MPL; MPLV; TPOR; C-MPL; CD110; THCYT2; TPOR; TPO-R

uniprot entry name :

TPOR_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

26-491

sequence length :

635

sequence :

QDVSLLASDSEPLKCFSRTFEDLTCFWDEEEAAPSGTYQ
LLYAYPREKPRACPLSSQSMPHFGTRYVCQFPDQEEVRL
FFPLHLWVKNVFLNQTRTQRVLFVDSVGLPAPPSIIKAM
GGSQPGELQISWEEPAPEISDFLRYELRYGPRDPKNSTG
PTVIQLIATETCCPALQRPHSASALDQSPCAQPTMPWQD
GPKQTSPSREASALTAEGGSCLISGLQPGNSYWLQLRSE
PDGISLGGSWGSWSLPVTVDL

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Immunology

products description :

Receptor for thrombopoietin. May represent a regulatory molecule specific for TPO-R-dependent immune responses.

products references :

Molecular cloning and characterization of MPL, the human homolog of the v-mpl oncogene identification of a member of the hematopoietic growth factor receptor superfamily.Vigon I., Mornon J.-P., Cocault L., Mitjavila M.-T., Tambourin P., Gisselbrecht S., Souyri M.Proc. Natl. Acad. Sci. U.S.A. 89:5640-5644(1992) Structure and transcription of the human c-mpl gene (MPL) .Mignotte V., Vigon I., Boucher de Crevecoeur E., Romeo P.-H., Lemarchandel V., Chretien S.Genomics 20:5-12(1994) The DNA sequence and biological annotation of human chromosome 1.Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.Nature 441:315-321(2006)

ncbi gi num :

4885491

ncbi acc num :

NP_005364.1

ncbi gb acc num :

NM_005373.2

uniprot acc num :

P40238

ncbi mol weight :

56.6kD

ncbi pathways :

Cytokine-cytokine Receptor Interaction Pathway (83051); Cytokine-cytokine Receptor Interaction Pathway (460); Hemostasis Pathway (1269340); Jak-STAT Signaling Pathway (83077); Jak-STAT Signaling Pathway (488); Platelet Aggregation (Plug Formation) Pathway (1269358); Platelet Activation, Signaling And Aggregation Pathway (1269350)

ncbi summary :

In 1990 an oncogene, v-mpl, was identified from the murine myeloproliferative leukemia virus that was capable of immortalizing bone marrow hematopoietic cells from different lineages. In 1992 the human homologue, named, c-mpl, was cloned. Sequence data revealed that c-mpl encoded a protein that was homologous with members of the hematopoietic receptor superfamily. Presence of anti-sense oligodeoxynucleotides of c-mpl inhibited megakaryocyte colony formation. The ligand for c-mpl, thrombopoietin, was cloned in 1994. Thrombopoietin was shown to be the major regulator of megakaryocytopoiesis and platelet formation. The protein encoded by the c-mpl gene, CD110, is a 635 amino acid transmembrane domain, with two extracellular cytokine receptor domains and two intracellular cytokine receptor box motifs . TPO-R deficient mice were severely thrombocytopenic, emphasizing the important role of CD110 and thrombopoietin in megakaryocyte and platelet formation. Upon binding of thrombopoietin CD110 is dimerized and the JAK family of non-receptor tyrosine kinases, as well as the STAT family, the MAPK family, the adaptor protein Shc and the receptors themselves become tyrosine phosphorylated. [provided by RefSeq, Jul 2008]

uniprot summary :

MPL: a hematopoietic receptor for thrombopoietin. Thrombopoietin is the major regulator of megakaryocytopoiesis and platelet formation. Dimerizes upon binding of thrombopoietin, leading to its phosphorylation and activation of JAKs and STATs. May represent a regulatory molecule specific for TPO-R-dependent immune responses. Two splice-variant isoforms have been described. Protein type: Membrane protein, integral; Receptor, cytokine. Chromosomal Location of Human Ortholog: 1p34. Cellular Component: cell surface; Golgi apparatus; integral to plasma membrane; plasma membrane. Molecular Function: protein binding; transmembrane receptor activity. Biological Process: blood coagulation; cell proliferation; cell surface receptor linked signal transduction; homeostasis of number of cells; negative regulation of apoptosis; platelet activation; platelet formation; regulation of chemokine production. Disease: Amegakaryocytic Thrombocytopenia, Congenital; Myelofibrosis; Thrombocythemia 2

size1 :

0.05 mg (E-Coli)

price1 :

185 USD

size2 :

0.2 mg (E-Coli)

price2 :

420

size3 :

0.5 mg (E-Coli)

price3 :

680

size4 :

1 mg (E-Coli)

price4 :

1070

more info or order :

MyBioSource product webpage