Recombinant Human Aquaporin-4 | MyBioSource MBS960179 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Aquaporin-4

catalog :

MBS960179

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS960179

products type :

Recombinant Protein

products full name :

Recombinant Human Aquaporin-4

products short name :

Aquaporin-4

products name syn :

Mercurial-insensitive water channel; MIWC WCH4

other names :

aquaporin-4 isoform M1; Aquaporin-4; aquaporin-4; aquaporin 4; Mercurial-insensitive water channel; MIWC; WCH4

products gene name :

AQP4

other gene names :

AQP4; AQP4; MIWC; WCH4; AQP-4; MIWC

uniprot entry name :

AQP4_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

253-323, partial, prvoide a complete intracellular at the C-terminal

sequence length :

323

sequence :

CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDD
LILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Transport

products description :

Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system.

products references :

cDNA cloning, gene organization, and chromosomal localization of a human mercurial insensitive water channel. Evidence for distinct transcriptional units.Yang B., Ma T., Verkman A.S.J. Biol. Chem. 270:22907-22913(1995) A water channel closely related to rat brain aquaporin 4 is expressed in acid- and pepsinogen-secretory cells of human stomach.Misaka T., Abe K., Iwabuchi K., Kusakabe Y., Ichinose M., Miki K., Emori Y., Arai S.FEBS Lett. 381:208-212(1996) The human AQP4 gene definition of the locus encoding two water channel polypeptides in brain.Lu M., Lee M.D., Smith B.L., Jung J.S., Agre P., Verdijk M.A.J., Merkx G., Rijss J.P.L., Deen P.M.T.Proc. Natl. Acad. Sci. U.S.A. 93:10908-10912(1996) DNA sequence and analysis of human chromosome 18.Nusbaum C., Zody M.C., Borowsky M.L., Kamal M., Kodira C.D., Taylor T.D., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Abouelleil A., Allen N.R., Anderson S., Bloom T., Bugalter B., Butler J., Cook A., DeCaprio D., Engels R., Garber M., Gnirke A., Hafez N., Hall J.L., Norman C.H., Itoh T., Jaffe D.B., Kuroki Y., Lehoczky J., Lui A., Macdonald P., Mauceli E., Mikkelsen T.S., Naylor J.W., Nicol R., Nguyen C., Noguchi H., O'Leary S.B., Piqani B., Smith C.L., Talamas J.A., Topham K., Totoki Y., Toyoda A., Wain H.M., Young S.K., Zeng Q., Zimmer A.R., Fujiyama A., Hattori M., Birren B.W., Sakaki Y., Lander E.S.Nature 437:551-555(2005) Megalencephalic leukoencephalopathy with subcortical cysts protein 1 functionally cooperates with the TRPV4 cation channel to activate the response of astrocytes to osmotic stress dysregulation by pathological mutations.Lanciotti A., Brignone M.S., Molinari P., Visentin S., De Nuccio C., Macchia G., Aiello C., Bertini E., Aloisi F., Petrucci T.C., Ambrosini E.Hum. Mol. Genet. 21:2166-2180(2012) Crystal structure of human aquaporin 4 at 1.8 A and its mechanism of conductance.Ho J.D., Yeh R., Sandstrom A., Chorny I., Harries W.E., Robbins R.A., Miercke L.J., Stroud R.M.Proc. Natl. Acad. Sci. U.S.A. 106:7437-7442(2009)

ncbi gi num :

4502181

ncbi acc num :

NP_001641.1

ncbi gb acc num :

NM_001650.5

uniprot acc num :

P55087

ncbi mol weight :

23.98kD

ncbi pathways :

Aquaporin-mediated Transport Pathway (1269944); Bile Secretion Pathway (193146); Bile Secretion Pathway (193095); Passive Transport By Aquaporins Pathway (1269945); SIDS Susceptibility Pathways (198901); Spinal Cord Injury Pathway (739007); Transmembrane Transport Of Small Molecules Pathway (1269903); Vasopressin Regulates Renal Water Homeostasis Via Aquaporins Pathway (1269946); Vasopressin-regulated Water Reabsorption Pathway (143700); Vasopressin-regulated Water Reabsorption Pathway (143631)

ncbi summary :

This gene encodes a member of the aquaporin family of intrinsic membrane proteins that function as water-selective channels in the plasma membranes of many cells. This protein is the predominant aquaporin found in brain and has an important role in brain water homeostasis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. A recent study provided evidence for translational readthrough in this gene and expression of an additional C-terminally extended isoform via the use of an alternative in-frame translation termination codon. [provided by RefSeq, Dec 2015]

uniprot summary :

AQP4: a member of the aquaporin family of intrinsic membrane proteins that function as water-selective channels in the plasma membranes of many cells. The predominant aquaporin found in brain. Two alternatively spliced transcript variants have been described. Protein type: Membrane protein, integral; Membrane protein, multi-pass; Transporter; Channel, misc.; Transporter, aquaporin family. Chromosomal Location of Human Ortholog: 18q11.2-q12.1. Cellular Component: basolateral plasma membrane; cytoplasm; external side of plasma membrane; integral to membrane; plasma membrane. Molecular Function: glycerol channel activity; water channel activity; water transporter activity. Biological Process: glycerol transport; multicellular organismal water homeostasis; renal water homeostasis; transmembrane transport; transport; water transport

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.05 mg (Yeast)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.2 mg (Yeast)

price4 :

460

size5 :

0.5 mg (Yeast)

price5 :

750

more info or order :

MyBioSource product webpage