product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Rat Zinc transporter 8 (Slc30a8)
catalog :
MBS960057
quantity :
1 mg (E Coli Derived
price :
1760 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS960057
products type :
Recombinant Protein
products full name :
Recombinant Rat Zinc transporter 8 (Slc30a8)
products short name :
Zinc transporter 8 (Slc30a8)
products name syn :
Recombinant Zinc transporter 8 (Slc30a8); Zinc transporter 8; ZnT-8; Solute carrier family 30 member 8
other names :
zinc transporter 8; Zinc transporter 8; zinc transporter 8; solute carrier family 30 member 8; solute carrier family 30 (zinc transporter), member 8; Solute carrier family 30 member 8
products gene name syn :
Slc30a8; Znt8
other gene names :
Slc30a8; Slc30a8; ZnT-8; Znt8; ZnT-8
uniprot entry name :
ZNT8_RAT
host :
E Coli or Yeast
sequence positions :
1-368
sequence length :
368
sequence :
MEFLERTYLVNDQATKMYAFTSDRERGQKPVNKDQCPGD
GPERPEAGAIYHCHNSFKATGNRSSKQVHAKWRLCAASA
ICFFFMVAEVVGGHVAGSLAVLTDAAHLLIDLTSFLLSL
FSLWLSSRPPSKRLTFGWYRAEILGALLSVLCIWVVTGV
LVYLACERLLYPDYQIQAGIMITVSGCAVAANIVLTLIL
HQRHLGHNHKDAQANASVRAAFVHALGDVFQSTSVLISA
LIIYFKPDYKMADPVCTFISSVLALASTVMILKDFSILL
MEGVPKGLSYNSVKELLLTVDGVISVHNLHIWSLTVNQV
ILSVHVATAASQDSQSVRTGIACALSSSFDLHSLTIQIE
SAADQDPSCLLCEDPQD
purity :
>90%
form :
This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Tag Information: His tagged (Host tag may vary. Please inquire for specific tag information). Species: Rattus norvegicus (Rat)
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
ncbi gi num :
194474016
ncbi acc num :
NP_001124010.1
ncbi gb acc num :
NM_001130538.1
uniprot acc num :
P0CE46
ncbi mol weight :
40,128 Da
ncbi pathways :
Metal Ion SLC Transporters Pathway 649848!!SLC-mediated Transmembrane Transport Pathway 649828!!Transmembrane Transport Of Small Molecules Pathway 649824!!Transport Of Glucose And Other Sugars, Bile Salts And Organic Acids, Metal Ions And Amine Compounds Pathway 649841!!Zinc Efflux And Compartmentalization By The SLC30 Family Pathway 649850!!Zinc Transporters Pathway 649849
uniprot summary :
Function: Facilitates the accumulation of zinc from the cytoplasm into intracellular vesicles, being a zinc-efflux transporter . By similarity. May be a major component for providing zinc to insulin maturation and/or storage processes in insulin-secreting pancreatic beta-cells. Ref.3. Subunit structure: Homodimer . By similarity. Subcellular location: Cell membrane; Multi-pass membrane protein . By similarity. Cytoplasmic vesicle secretory vesicle membrane; Multi-pass membrane protein. Note: Associated with insulin and glucagon secretory granules . By similarity. Ref.2. Tissue specificity: Expressed in endocrine pancreatic islet alpha and beta cells. May be more abundant in beta cells than in alpha cells. Expressed in cubical epithelium lining thyroid follicles (at protein level). In the adrenal gland, detected in the cortex, but not in the medulla (at protein level). Ref.2. Induction: Down-regulated by IL1B and IFNG. Ref.4. Domain: Contains a histidine-rich region, HXXXXXHNH-motif, which is a ligand for zinc . By similarity. Sequence similarities: Belongs to the cation diffusion facilitator (CDF) transporter (TC 2.A.4) family. SLC30A subfamily. [View classification]. Sequence caution: The sequence EDM16273.1 differs from that shown. Reason: Erroneous gene model prediction.
size :
1 mg (E Coli Derived)
price :
1760 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!