product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Macaca mulatta (Rhesus macaque) Protransforming growth factor alpha (TGFA)
catalog :
MBS960036
quantity :
1 mg (E Coli Derived
price :
1085 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS960036
products type :
Recombinant Protein
products full name :
Recombinant Macaca mulatta (Rhesus macaque) Protransforming growth factor alpha (TGFA)
products short name :
(Rhesus macaque) Protransforming growth factor alpha (TGFA)
products name syn :
Storage Buffer PBS pH 7.4, 50% glycerol
other names :
Protransforming growth factor alpha; Protransforming growth factor alpha; protransforming growth factor alpha; transforming growth factor, alpha; EGF-like TGF; ETGF; TGF type 1
products gene name syn :
Recombinant (Rhesus macaque) Protransforming growth factor alpha (TGFA); Protransforming growth factor alpha Cleaved into the following chain: 1. Transforming growth factor alpha; 2. TGF-alpha; EGF-like TGF; ETGF TGF type 1
other gene names :
TGFA; TGFA; TGF alpha; TGF-alpha; ETGF
uniprot entry name :
TGFA_MACMU
host :
E Coli or Yeast
sequence positions :
Feb-75
sequence length :
121
sequence :
ENSTSLLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFL
VQEDRPACVCHSGYVGARCEHADLLAVVAASQKKQ
purity :
>90%
form :
This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Tag Information: GST tagged (Host tag may vary. Please inquire for specific tag information). Species: Macaca mulatta (Rhesus macaque)
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
products description :
TGFA
ncbi gi num :
1729920
ncbi acc num :
P55244.1
uniprot acc num :
P55244
ncbi mol weight :
13,182 Da
ncbi pathways :
ErbB Signaling Pathway 86719!!ErbB Signaling Pathway 458!!Glioma Pathway 86776!!Glioma Pathway 522!!Non-small Cell Lung Cancer Pathway 86785!!Non-small Cell Lung Cancer Pathway 531!!Pancreatic Cancer Pathway 86774!!Pancreatic Cancer Pathway 520!!Pathways In Cancer 86771!!Prostate Cancer Pathway 86777
uniprot summary :
Function: TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar . By similarity. Subunit structure: Interacts with the PDZ domains of MAGI3, SDCBP and SNTA1. The interaction with SDCBP, is required for the targeting to the cell surface. In the endoplasmic reticulum, in its immature form (i.e. with a prosegment and lacking full N-glycosylation), interacts with CNIH. In the Golgi apparatus, may form a complex with CNIH and GORASP2. Interacts (via cytoplasmic C-terminal domain) with NKD2 . By similarity. Subcellular location: Transforming growth factor alpha: Secreted extracellular space . By similarity. Protransforming growth factor alpha: Cell membrane; Single-pass type I membrane protein . By similarity. Tissue specificity: Hypothalamus. Ref.1. Developmental stage: Levels in the medial basal hypothalamus and preoptic area are elevated during neonatal life (1 week-6 months), decrease during juvenile development (8-18 months) and markedly increase during the expected time of puberty (30-36 months). Ref.1. Sequence similarities: Contains 1 EGF-like domain.
size :
1 mg (E Coli Derived)
price :
1085 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!