Recombinant Mouse Metalloproteinase inhibitor 1 | MyBioSource MBS959921 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Mouse Metalloproteinase inhibitor 1

catalog :

MBS959921

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS959921

products type :

Recombinant Protein

products full name :

Recombinant Mouse Metalloproteinase inhibitor 1

products short name :

Metalloproteinase inhibitor 1

products name syn :

Collagenase inhibitor 16C8 fibroblast; Erythroid-potentiating activity; EPA; TPA-S1; TPA-induced protein; Tissue inhibitor of metalloproteinases 1; TIMP-1

other names :

metalloproteinase inhibitor 1 isoform a; Metalloproteinase inhibitor 1; metalloproteinase inhibitor 1; tissue inhibitor of metalloproteinase 1; Collagenase inhibitor 16C8 fibroblast; Erythroid-potentiating activity; EPA; TPA-S1; TPA-induced protein; Tissue inhibitor of metalloproteinases 1; TIMP-1

products gene name :

Timp1

other gene names :

Timp1; Timp1; EPA; Clgi; Timp; TIMP-1; TPA-S1; Timp; Timp-1; EPA; TIMP-1

uniprot entry name :

TIMP1_MOUSE

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

25-205

sequence length :

205

sequence :

CSCAPPHPQTAFCNSDLVIRAKFMGSPEINETTLYQRYK
IKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQN
RSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFS
KTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSE
DYQSRHFACLPRNPGLCTWRSLGAR

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling. 1 Publication

products references :

Characterization and expression of a murine gene homologous to human EPA/TIMP a virus-induced gene in the mouse.Gewert D.R., Coulombe B., Castelino M., Skup D., Williams B.R.G.EMBO J. 6:651-657(1987) A growth-responsive gene (16C8) in normal mouse fibroblasts homologous to a human collagenase inhibitor with erythroid-potentiating activity evidence for inducible and constitutive transcripts.Edwards D.R., Waterhouse P., Holman M.L., Denhardt D.T.Nucleic Acids Res. 14:8863-8878(1986) Molecular cloning of gene sequences regulated by tumor promoters and mitogens through protein kinase C.Johnson M.D., Housey G.M., Kirschmeier P.T., Weinstein I.B.Mol. Cell. Biol. 7:2821-2829(1987) Genes for extracellular-matrix-degrading metalloproteinases and their inhibitor, TIMP, are expressed during early mammalian development.Brenner C.A., Adler R.R., Rappolee D.A., Pedersen R.A., Werb Z.Genes Dev. 3:848-859(1989) Molecular cloning of partial cDNA copies of two distinct mouse IFN-beta mRNAs.Skup D., Windass J.D., Sor F.S., George H., Williams B.R., Fukuhara H., de Maeyer-Guignard J., de Maeyer E.Nucleic Acids Res. 10:3069-3084(1982) Timp1 interacts with beta-1 integrin and CD63 along melanoma genesis and confers anoikis resistance by activating PI3-K signaling pathway independently of Akt phosphorylation.Toricelli M., Melo F.H., Peres G.B., Silva D.C., Jasiulionis M.G.Mol. Cancer 12:22-22(2013)

ncbi gi num :

113205063

ncbi acc num :

NP_001037849.1

ncbi gb acc num :

NM_001044384.1

uniprot acc num :

P12032

ncbi mol weight :

36.23kD

ncbi pathways :

Activation Of Matrix Metalloproteinases Pathway (1323923); Degradation Of The Extracellular Matrix Pathway (1323922); Extracellular Matrix Organization Pathway (1323909); HIF-1 Signaling Pathway (695223); Hemostasis Pathway (1323559); Matrix Metalloproteinases Pathway (198370); Platelet Activation, Signaling And Aggregation Pathway (1323569); Platelet Degranulation Pathway (1323586); Response To Elevated Platelet Cytosolic Ca2+ Pathway (1323584)

uniprot summary :

TIMP1: Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Also mediates erythropoiesis in vitro; but, unlike IL-3, it is species-specific, stimulating the growth and differentiation of only human and murine erythroid progenitors. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-11, MMP-12, MMP-13 and MMP-16. Does not act on MMP-14. Belongs to the protease inhibitor I35 (TIMP) family. Protein type: Secreted; Motility/polarity/chemotaxis; Secreted, signal peptide. Cellular Component: basement membrane; extracellular matrix; extracellular region; extracellular space; proteinaceous extracellular matrix. Molecular Function: cytokine activity; enzyme inhibitor activity; growth factor activity; metal ion binding; metalloendopeptidase inhibitor activity; protease binding; protease inhibitor activity. Biological Process: cell activation; negative regulation of apoptosis; negative regulation of membrane protein ectodomain proteolysis; negative regulation of metalloenzyme activity; negative regulation of peptidase activity; positive regulation of cell proliferation; response to cytokine stimulus; response to hormone stimulus

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

0.05 mg (Baculovirus)

price4 :

925

size5 :

0.05 mg (Mammalian-Cell)

price5 :

1150

more info or order :

MyBioSource product webpage