catalog number :
MBS959628
products type :
Recombinant Protein
products full name :
Recombinant Human Voltage-dependent calcium channel subunit alpha-2/delta-1
products short name :
Voltage-dependent calcium channel subunit alpha-2/delta-1
products name syn :
Voltage-gated calcium channel subunit alpha-2/delta-1
other names :
voltage-dependent calcium channel subunit alpha-2/delta-1 preproprotein; Voltage-dependent calcium channel subunit alpha-2/delta-1; voltage-dependent calcium channel subunit alpha-2/delta-1; calcium voltage-gated channel auxiliary subunit alpha2delta 1; Voltage-gated calcium channel subunit alpha-2/delta-1
products gene name :
CACNA2D1
other gene names :
CACNA2D1; CACNA2D1; CACNA2; CCHL2A; CACNL2A; LINC01112; lncRNA-N3; CACNL2A; CCHL2A; MHS3
uniprot entry name :
CA2D1_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
528-668
sequence :
KMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGT
DYSLALVLPTYSFYYIKAKLEETITQARYSETLKPDNFE
ESGYTFIAPRDYCNDLKISDNNTEFLLNFNEFIDRKTPN
NPSCNADLINRVLLDAGFTNELVQ
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Neuroscience
products description :
The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Plays an important role in excitation-contraction coupling.
products references :
Structure and functional expression of alpha 1, alpha 2, and beta subunits of a novel human neuronal calcium channel subtype.Williams M.E., Feldman D.H., McCue A.F., Brenner R., Velicelebi G., Ellis S.B., Harpold M.M.Neuron 8:71-84(1992)
ncbi acc num :
NP_000713.2
ncbi gb acc num :
NM_000722.3
ncbi pathways :
Adrenergic Signaling In Cardiomyocytes Pathway (908257); Adrenergic Signaling In Cardiomyocytes Pathway (909696); Arrhythmogenic Right Ventricular Cardiomyopathy Pathway (672454); Arrhythmogenic Right Ventricular Cardiomyopathy (ARVC) Pathway (117293); Arrhythmogenic Right Ventricular Cardiomyopathy (ARVC) Pathway (116129); Cardiac Conduction Pathway (1339115); Cardiac Muscle Contraction Pathway (93344); Cardiac Muscle Contraction Pathway (93992); Depolarization Of The Presynaptic Terminal Triggers The Opening Of Calcium Channels Pathway (1268767); Dilated Cardiomyopathy Pathway (121494)
ncbi summary :
The preproprotein encoded by this gene is cleaved into multiple chains that comprise the alpha-2 and delta subunits of the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization. Mutations in this gene can cause cardiac deficiencies, including Brugada syndrome and short QT syndrome. Alternate splicing results in multiple transcript variants, some of which may lack the delta subunit portion. [provided by RefSeq, Nov 2014]
uniprot summary :
CACNA2D1: The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Plays an important role in excitation-contraction coupling. Belongs to the calcium channel subunit alpha-2/delta family. 5 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, integral; Channel, calcium. Chromosomal Location of Human Ortholog: 7q21-q22. Cellular Component: plasma membrane; sarcoplasmic reticulum; voltage-gated calcium channel complex. Molecular Function: metal ion binding; voltage-gated calcium channel activity. Biological Process: calcium ion transport; regulation of calcium ion transport