product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Rat Fatty acid-binding protein, heart
catalog :
MBS959526
quantity :
0.01 mg (E-Coli)
price :
135 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS959526
products type :
Recombinant Protein
products full name :
Recombinant Rat Fatty acid-binding protein, heart
products short name :
Fatty acid-binding protein
products name syn :
Fatty acid-binding protein 3; Heart-type fatty acid-binding protein; H-FABP
other names :
fatty acid-binding protein, heart; Fatty acid-binding protein, heart; fatty acid-binding protein, heart; fatty acid binding protein 3; Fatty acid-binding protein 3; Heart-type fatty acid-binding protein; H-FABP
products gene name :
Fabp3
other gene names :
Fabp3; Fabp3; H-FABP
uniprot entry name :
FABPH_RAT
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
2-133
sequence length :
133
sequence :
YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTV
SCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAAL
AIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQ
GLWRRFNRPLLKQQ
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Rat
products categories :
Cardiovascular
products description :
FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.
products references :
Cloning and tissue distribution of rat heart fatty acid binding protein mRNA: identical forms in heart and skeletal muscle." Claffey K.P., Herrera V.L., Brecher P., Ruiz-Opazo N. Biochemistry 26:7900-7904(1987)
ncbi gi num :
13162363
ncbi acc num :
NP_077076.1
ncbi gb acc num :
NM_024162.1
uniprot acc num :
P07483
ncbi mol weight :
30.92kD
ncbi pathways :
Hormone-sensitive Lipase (HSL)-mediated Triacylglycerol Hydrolysis Pathway (1333318); Lipid Digestion, Mobilization, And Transport Pathway (1333311); Metabolism Pathway (1333271); Metabolism Of Lipids And Lipoproteins Pathway (1333310); PPAR Signaling Pathway (83434); PPAR Signaling Pathway (450)
ncbi summary :
binds fatty acids; may play a role in fatty acid metabolism possibly including mitochondrial beta-oxidation of fatty acids [RGD, Feb 2006]
uniprot summary :
FABP3: FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. Protein type: Lipid-binding. Cellular Component: cytoplasm; cytosol; extracellular space; mitochondrion; sarcoplasm; sarcoplasmic reticulum. Molecular Function: cytoskeletal protein binding; fatty acid binding; icosatetraenoic acid binding; long-chain fatty acid transporter activity. Biological Process: cholesterol homeostasis; fatty acid beta-oxidation; fatty acid metabolic process; long-chain fatty acid transport; phospholipid homeostasis; regulation of fatty acid oxidation; response to drug; response to insulin stimulus
size1 :
0.01 mg (E-Coli)
price1 :
135 USD
size2 :
0.05 mg (E-Coli)
price2 :
255
size3 :
0.02 mg (Mammalian-Cell)
price3 :
295
size4 :
0.05 mg (Mammalian-Cell)
price4 :
575
size5 :
0.2 mg (E-Coli)
price5 :
665
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!