catalog number :
MBS959482
products type :
Recombinant Protein
products full name :
Recombinant Macaca mulatta (Rhesus macaque) Interleukin-1 receptor accessory protein (IL1RAP)
products short name :
(Rhesus macaque) Interleukin-1 receptor accessory protein (IL1RAP)
products name syn :
Recombinant (Rhesus macaque) Interleukin-1 receptor accessory protein (IL1RAP); Interleukin-1 receptor accessory protein; IL-1 receptor accessory protein; IL-1RAcP
other names :
interleukin-1 receptor accessory protein; Interleukin-1 receptor accessory protein; interleukin-1 receptor accessory protein; IL-1RAcP; IL-1 receptor accessory protein
products gene name syn :
IL1RAP
other gene names :
IL1RAP; IL1RAP; IL-1 receptor accessory protein; IL-1RAcP
uniprot entry name :
IL1AP_MACMU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
21-367
sequence :
SERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYS
TAHSAGLTLIWYWTRQDRDLEEPINFRLPENRISKEKDV
LWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSC
FNSPMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTIT
WYMGCYKIQNFNNVIPEGMNLSFLIAFISNNGNYTCVVT
YPENGRTFHLTRTLTVKVVGSPKNAVPPVIHSPNDHVVY
EKEPGEELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDIP
IDVTINESISHSRTEDETRTQILSIKKVTSEDLKRSYVC
HARSAKGEVAKAATVKQKVPAPRYTVELACGFGAT
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Species: Macaca mulatta (Rhesus macaque)
ncbi acc num :
NP_001028132.1
ncbi gb acc num :
NM_001032960.1
ncbi mol weight :
65,393 Da
ncbi pathways :
Apoptosis Pathway (86730); Apoptosis Pathway (470); Cytokine-cytokine Receptor Interaction Pathway (86721); Cytokine-cytokine Receptor Interaction Pathway (460)
uniprot summary :
Function: Coreceptor with IL1R1. Associates with IL1R1 bound to IL1B to form the high affinity interleukin-1 receptor complex which mediates interleukin-1-dependent activation of NF-kappa-B and other pathways. Signaling involves the recruitment of adapter molecules such as TOLLIP, MYD88, and IRAK1 or IRAK2 via the respective TIR domains of the receptor/coreceptor subunits. Recruits TOLLIP to the signaling complex. Does not bind to interleukin-1 alone; binding of IL1RN to IL1R1, prevents its association with IL1R1 to form a signaling complex. The cellular response is modulated through a non-signaling association with the membrane IL1R2 decoy receptor. Secreted forms (isoforms 2 and 3) associate with secreted ligand-bound IL1R2 and increase the affinity of secreted IL1R2 for IL1B; this complex formation may be the dominant mechanism for neutralization of IL1B by secreted/soluble receptors . By similarity. Ref.1. Subunit structure: The interleukin-1 receptor complex is a heterodimer of IL1R1 and IL1RAP. Associates with IL1R2 to form a non-signaling interleukin-1 receptor complex . By similarity. Subcellular location: Isoform 1: Cell membrane; Single-pass type I membrane protein. Isoform 2: Secreted. Sequence similarities: Belongs to the interleukin-1 receptor family.Contains 3 Ig-like C2-type (immunoglobulin-like) domains.Contains 1 TIR domain.